hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/msj/msj04008/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0012 ( 727 res) msj04008 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIR Toll - interleukin 1 - resistance 151.8 7e-41 1 LRR_TYP Leucine-rich repeats, typical (most populate 56.9 2.6e-12 6 LRRCT Leucine rich repeat C-terminal domain 52.2 6.7e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LRR_TYP 1/6 3 26 .. 1 24 [] 14.7 6.7 LRR_TYP 2/6 48 72 .. 1 24 [] 0.3 3.8e+02 LRR_TYP 3/6 306 329 .. 1 24 [] 12.8 11 LRR_TYP 4/6 332 355 .. 1 24 [] 7.0 57 LRR_TYP 5/6 380 401 .. 1 24 [] 6.2 73 LRR_TYP 6/6 402 426 .. 1 24 [] 15.5 5.3 LRRCT 1/1 459 513 .. 1 55 [] 52.2 6.7e-11 TIR 1/1 571 714 .. 1 147 [] 151.8 7e-41 Alignments of top-scoring domains: LRR_TYP: domain 1 of 6, from 3 to 26: score 14.7, E = 6.7 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++Lr+L s+N+L+ L +F mKIAA0012 3 LSKLRVLIMSYNRLQYLNISVFKF 26 LRR_TYP: domain 2 of 6, from 48 to 72: score 0.3, E = 3.8e+02 *->LpnLreLdLsnNqLtsLP..pgaFqg<-* ++L++LdLs+N++ +LP + F++ mKIAA0012 48 TVSLKHLDLSFNAFDALPicKE-FGN 72 LRR_TYP: domain 3 of 6, from 306 to 329: score 12.8, E = 11 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+ L++L+L+ NqL+ L + ++ + mKIAA0012 306 LVRLKTLSLQKNQLKNLENIILTS 329 LRR_TYP: domain 4 of 6, from 332 to 355: score 7.0, E = 57 *->LpnLreLdLsnNqLtsLPpgaFqg<-* +++L++Ld s N L+ g+ mKIAA0012 332 MTSLQKLDISQNSLRYSDGGIPCA 355 LRR_TYP: domain 5 of 6, from 380 to 401: score 6.2, E = 73 *->LpnLreLdLsnNqLtsLPpgaFqg<-* p+ ++LdL+nN++ s+P ++ + mKIAA0012 380 -PKVKVLDLHNNRIMSIPKDV-TH 401 LRR_TYP: domain 6 of 6, from 402 to 426: score 15.5, E = 5.3 *->LpnLreLdLsnNqLtsLP.pgaFqg<-* L +L+eL+ +N Lt LP+ gaF++ mKIAA0012 402 LQALQELNVASNSLTDLPgCGAFSS 426 LRRCT: domain 1 of 1, from 459 to 513: score 52.2, E = 6.7e-11 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll NPf C+CeLr+++ ++ + +e+++++ +s+rC++Pes rG+ l+++ mKIAA0012 459 NPFQCTCELRDFVKNIGWVAREVVEGWPDSYRCDYPESSRGTALRDF 505 lpsefsCp<-* ++s sC+ mKIAA0012 506 HMSPLSCD 513 TIR: domain 1 of 1, from 571 to 714: score 151.8, E = 7e-41 *->eydvFiSfrg.deedvrnefvshLlkalrgkgklcvFiDdfepgggd ++ +F+S++g+d+++v ne+++ L+k+ ++c+++++f+pg+++ mKIAA0012 571 QFHAFVSYSGhDSAWVKNELLPNLEKDDI---QICLHERNFVPGKSI 614 aenkllpelfeaIekSriaivvlSpnYaeSeWCldlElvaalecale.gg +en ++ IekS ++i+vlSp++++SeWC El +a+++ +++g+ mKIAA0012 615 VEN-----IINFIEKSYKSIFVLSPHFIQSEWCHY-ELYFAHHNLFHeGS 658 lrvIPIfyevi..sdvrkqtgkfgkvfkkngpedtylkwted......fW +++I+I + +i+++ ++ k+++++ ++ tyl+w+ ++++++ fW mKIAA0012 659 DNLILILLAPIpqYSIPTNYHKLKTLMSRR----TYLEWPTEknkhglFW 704 kkalysvpnk<-* ++++s+ +k mKIAA0012 705 ANLRASINVK 714 //