hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/meg/meg01347/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0005 ( 424 res) meg01347 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- eIF5C Domain at the C-termini of GCD6, eIF-2B epsi 138.1 9.2e-37 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- eIF5C 1/1 330 415 .. 1 92 [] 138.1 9.2e-37 Alignments of top-scoring domains: eIF5C: domain 1 of 1, from 330 to 415: score 138.1, E = 9.2e-37 *->gpllkfllkdeeeqlelLyaiEefcvelekellkllpkilksLYDeD +pll++++++++++l lL++i+e+c+++ + ++k ++ki++++Y ++ mKIAA0005 330 SPLLAAFTTQGQSELTLLLKIQEYCYDNIH-FMKAFQKIVVLFYKAE 375 vleEeaIlkWyekkSKkyvsaeekskvrknakpqFvtWLqeAEEE<-* vl+Ee IlkWy+++ ++a++ks++++++k+ Fv+WL++AEEE mKIAA0005 376 VLSEEPILKWYKDA----HVAKGKSVFLEQMKK-FVEWLKNAEEE 415 //