hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/msh/msh01094/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0003 ( 521 res) msh01094 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Fibrinogen_C Fibrinogen beta and gamma chains, C-term 264.9 1.1e-75 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Fibrinogen_C 1/1 305 519 .. 1 272 [] 264.9 1.1e-75 Alignments of top-scoring domains: Fibrinogen_C: domain 1 of 1, from 305 to 519: score 264.9, E = 1.1e-75 *->spkDCsdilqkRPGgktSPPsGlYtIqPdgakekpleVYCDMeTdGG +DC d++q G S G YtI+ + p +V+C M+ GG mKIAA0003 305 PFRDCADVYQA--GFNKS---GIYTIYFNNMP-EPKKVFCNMDVNGG 345 GWTVfQrRqDGslnFyRnWkdYkeGFGnlstsgtGkkYCglpgEFWLGNd GWTV+Q R+DGsl+F R Wk+Yk GFGn+s gE+WLGN+ mKIAA0003 346 GWTVIQHREDGSLDFQRGWKEYKMGFGNPS------------GEYWLGNE 383 kihlLTkqgsipyeLRveLeDwnGetvyAlYdkFtVgdeankYrLsvsgY i +T+q +y LR+eL Dw G+ +y +Yd F++g+e+ YrL + g mKIAA0003 384 FIFAITSQR--QYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGH 431 sGGtAGnALveGasqlvtagd..smtyHNGmfFSTyDrDNDgWsTtspsg G tag+++s+ H G FST D DND mKIAA0003 432 TG---------------TAGKqsSLILH-GADFSTKDADND-----NCMC 460 nCAesyggGRGaWWynsChaANLNGrYYyGgtyspqEmaphGtDnGvvWa CA+ gG WW+++C +NLNG Y g+++ nG+ W mKIAA0003 461 KCALMLTGG---WWFDACGPSNLNGMFYTAGQNHGK-------LNGIKWH 500 tWkGsnqAqPGGYwySmkfaeMKiRPr<-* ++kG yS++ ++M+iRP+ mKIAA0003 501 YFKGP--------SYSLRSTTMMIRPL 519 //