hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mlj/mlj03177/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00400 ( 603 res) mlj03177 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TMC TMC domain 247.1 2.4e-70 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TMC 1/1 303 413 .. 1 116 [] 247.1 2.4e-70 Alignments of top-scoring domains: TMC: domain 1 of 1, from 303 to 413: score 247.1, E = 2.4e-70 *->CWETfVGQElYKLvifDFlftllvtflveFlRrllvrylsskwlWDl CWE++VG+ElYKL+if+Fl+t++++flv+++Rrllv+++s++ + mFLJ00400 303 CWENSVGEELYKLIIFNFLLTVAFAFLVSLPRRLLVERFSGW-F--- 345 EltflgrqEFdvarNVLeLIYgQTlvWiGiFFcPLLPaIntiKlfilFYi +t+l+r+EF v++NVL+++++QT++W+G+F+cPLLP++n+++lf++FYi mFLJ00400 346 -WTWLDREEFLVPKNVLDIVAAQTVTWMGLFYCPLLPLLNSVFLFLTFYI 394 KKisLltNcrPpsrpFRAS<-* KK++Ll+N+r+++r+FRAS mFLJ00400 395 KKYTLLRNSRASPRRFRAS 413 //