hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbh/mbh03491/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00394 ( 310 res) mbh03491 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UBX UBX domain 15.7 0.035 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UBX 1/1 199 278 .. 1 90 [] 15.7 0.035 Alignments of top-scoring domains: UBX: domain 1 of 1, from 199 to 278: score 15.7, E = 0.035 *->ekaedvcrlqiRlPDGsRlvrrFnssdtlqdvydfvdshrygadepe ++ ++ +++RlPDG l+ +F + ++l++++ fv + + p mFLJ00394 199 LRKYTYALVRVRLPDGCLLQGTFYAREKLSALFRFVREALQNDWLP- 244 dYkheFeFsLltpfPrrlltkldesktLkeagllpnstlvlep<-* F+L + +l ++ L+e gl p++ l + + mFLJ00394 245 -------FELRASGGQKLEENEA--LALNECGLVPSALLTFSW 278 //