hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/msh/msh01286/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00385 ( 303 res) msh01286 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- C1-set Immunoglobulin C1-set domain 179.4 5.9e-50 2 ig Immunoglobulin domain 44.8 1.9e-09 2 C2-set_2 CD80-like C2-set immunoglobulin domain 13.7 0.022 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ig 1/2 41 110 .. 1 65 [] 17.2 0.39 C1-set 1/2 31 120 .. 1 92 [] 64.9 1.7e-15 ig 2/2 147 214 .. 1 65 [] 29.4 8.3e-05 C2-set_2 1/1 136 223 .. 1 101 [] 13.7 0.022 C1-set 2/2 139 225 .. 1 92 [] 118.8 9.9e-32 Alignments of top-scoring domains: ig: domain 1 of 2, from 41 to 110: score 17.2, E = 0.39 *->GesvtLtCsvs..gfgppdvtvtWlrngk.ltgvlvtssenngdsty + + tC v + ++ +pdv+v+W++++k+++ + e + +st+ mFLJ00385 41 SLTPKVTCVVVdvSEDDPDVHVSWFVDNKeVHTAWTQPREAQYNSTF 87 qt..sLtitnvtpeDggtYtCvv<-* + + L i+ ++ g +++C v mFLJ00385 88 RVvsALPIQHQDWMRGKEFKCKV 110 C1-set: domain 1 of 2, from 31 to 120: score 64.9, E = 1.7e-15 *->ppgspepel..gkpntLvClVtgFyP..pdItVtWlkNGqevtegve pp +p + l + + ++C V + + ++pd+ V+W+++++ev+++ + mFLJ00385 31 PP-KPKDALmiSLTPKVTCVVVDVSEddPDVHVSWFVDNKEVHTAWT 76 steplpkngDgtYqlsSyLtftasepesgdsYtCrVeHesLkvenePlt< +++ ++t+++ S L+++++++ +g++++C+V ++L+ P++ mFLJ00385 77 QPREAQ--YNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALP---APIE 120 -* mFLJ00385 - - ig: domain 2 of 2, from 147 to 214: score 29.4, E = 8.3e-05 *->GesvtLtCsvsgfgppdvtvtWlrngk.lt.gvlvtssenngdstyq ++v+LtC v++f+++ ++v W rng ++ + ++++ ++ mFLJ00385 147 KKKVSLTCLVTNFFSEAISVEWERNGElEQdYKNTPPILDSDGTYFL 193 t.sLtitnvtpeDggtYtCvv<-* ++ Lt+ ++ g+++tC v mFLJ00385 194 YsKLTVDTDSWLQGEIFTCSV 214 C2-set_2: domain 1 of 1, from 136 to 223: score 13.7, E = 0.022 *->peIeppasllegeksenlevvatCvlpysag..GkPapritWyldgk +I pp ++ + +v +tC+ +++ ++ a ++ W+++g+ mFLJ00385 136 YTIPPPREQMSKK-----KVSLTCL---VTNffSE-AISVEWERNGE 173 elvpeekteaittsseqdpesglytvtStLklvpsredhgqsltCqvsyg +++ + + + g+y ++S+L++ + + g ++tC+v ++ mFLJ00385 174 LE------QDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHE 217 alrgsk<-* al+ + mFLJ00385 218 ALHNHH 223 C1-set: domain 2 of 2, from 139 to 225: score 118.8, E = 9.9e-32 *->ppgspepel.gkpntLvClVtgFyPpdItVtWlkNGqevtegveste pp ++e ++++k+++L+ClVt+F+ + I+V+W +NG+ e ++++ mFLJ00385 139 PP-PRE-QMsKKKVSLTCLVTNFFSEAISVEWERNGEL--EQDYKNT 181 plpkngDgtYqlsSyLtftasepesgdsYtCrVeHesLkvenePlt<-* p+ +++DgtY+l+S+Lt+ + + +g+++tC+V He+L+ n++++ mFLJ00385 182 PPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALH--NHHTQ 225 //