hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbj/mbj00894/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00324 ( 348 res) mbj00894 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or 141.2 1.9e-38 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RRM_1 1/2 24 95 .. 1 74 [] 61.1 2.4e-14 RRM_1 2/2 265 336 .. 1 74 [] 80.0 4.8e-20 Alignments of top-scoring domains: RRM_1: domain 1 of 2, from 24 to 95: score 61.1, E = 2.4e-14 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lfVg L + eed+++lF++fG ie++ + r + g skG+aFV mFLJ00324 24 LFVGMLGKQQGEEDVRRLFQPFGHIEECTVLR---SPDGTSKGCAFV 67 eFedeedAekAldalnG.kelggrelrv<-* +F ++ +A++A++ l+G+++ g mFLJ00324 68 KFGSQGEAQAAIQGLHGsRTMTGASSSL 95 RRM_1: domain 2 of 2, from 265 to 336: score 80.0, E = 4.8e-20 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lf+ Lp++ +++L + F +fG ++s+k++ D r+t++sk f+FV mFLJ00324 265 LFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVD--RATNQSKCFGFV 309 eFedeedAekAldalnGkelggrelrv<-* F+++ +A+ A++a+nG+++g ++l+v mFLJ00324 310 SFDNPTSAQTAIQAMNGFQIGMKRLKV 336 //