hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mic/mic33003/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00288 ( 329 res) mic33003 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TBC TBC domain 24.6 1.4e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TBC 1/1 1 153 [. 1 219 [] 24.6 1.4e-08 Alignments of top-scoring domains: TBC: domain 1 of 1, from 1 to 153: score 24.6, E = 1.4e-08 *->vkeGvpsstrakVWavcsgAyqlrYAsageYerllrrgdekesqavd +l+ sq mFLJ00288 1 ---------------------PLH------------------SQ--- 5 kIekDvkRtLvkesaFqsrGKGegiskLrrvLvAYswknPdvgYcQGMNV + L rvL AY +P+ gYcQ+ mFLJ00288 6 -------------------------QDLFRVLKAYTLYRPEEGYCQAQAP 30 vaApfLllykSEeqAFyfLdrLlenvvPlKYylpdldGvrlDqkvLdsfv +aA +L+ + eqAF++L +++e ++P+ Yy+ l lD +L s + mFLJ00288 31 IAAVLLMHM-PAEQAFWCLVQVCEKYLPG-YYSEKLEAIQLDGEILFSLL 78 eellprLYeYLlskgvdlkvvsLpwfLsLyattlPleeAlrIfDiLFadG p+ +L +d + wf +a tlP + lr++D++F++G mFLJ00288 79 QKVSPVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVLRVWDMFFCEG 128 ivllfrvaLAvLkilk...eqiLda<-* + frv L Lk +++e + ++ mFLJ00288 129 VKIIFRVGLVLLKHALgspEKLKAC 153 //