hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mid/mid06072/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mFLJ00261  ( 183 res)   mid06072

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SH3      Src homology 3 domains                          64.8    1.1e-14   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SH3        1/1      99   156 ..     1    58 []    64.8  1.1e-14

Alignments of top-scoring domains:
SH3: domain 1 of 1, from 99 to 156: score 64.8, E = 1.1e-14
                   *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG
                      ++v+ l +y++++ dEL ++k D++ v+++s+dgW+eG + ++G++G
   mFLJ00261    99    PQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGEQG 145  

                   lfPsnYVeeie<-*
                   +fP   Ve i    
   mFLJ00261   146 WFPVQQVEFIS    156  

//