hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mfj/mfj01101/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mFLJ00238  ( 1452 res)   mfj01101

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FYVE     Protein present in Fab1, YOTB, Vac1, and EEA    68.9    6.5e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FYVE       1/1    1139  1206 ..     1    81 []    68.9  6.5e-16

Alignments of top-scoring domains:
FYVE: domain 1 of 1, from 1139 to 1206: score 68.9, E = 6.5e-16
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                        ++++  D e+++C ++C+ eF++ ++RrHHCR CGrifC  C+++
   mFLJ00238  1139    SAEEKCLGDMEVNHC-HDCKREFSW-IVRRHHCRICGRIFCYYCCNN 1183 

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                    +   + gk           + R+C++C+++      
   mFLJ00238  1184 YVVTKPSGK-----------KERCCRACFQKFGE    1206 

//