hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/msp/msp00191/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00204 ( 618 res) msp00191 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SH3 Src homology 3 domains 166.1 3.5e-45 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SH3 1/3 2 51 .. 1 58 [] 29.4 0.00049 SH3 2/3 201 258 .. 1 58 [] 73.6 2.5e-17 SH3 3/3 562 618 .] 1 58 [] 65.1 8.6e-15 Alignments of top-scoring domains: SH3: domain 1 of 3, from 2 to 51: score 29.4, E = 0.00049 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG + D + + d L+F+k++++tv++++dd+W eG l+ k+G mFLJ00204 2 -----MKDRDQ-DKDCLTFTKDEVLTVIRRVDDNWAEGMLG--DKIG 40 lfPsnYVeeie<-* +fP YVe+ + mFLJ00204 41 IFPLLYVELND 51 SH3: domain 2 of 3, from 201 to 258: score 73.6, E = 2.5e-17 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG ++ AlY+y++q dEL ++kG++++vlek+ dgW++G +tG G mFLJ00204 201 NVYLALYAYKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGVSG 247 lfPsnYVeeie<-* fP+nYV+++ mFLJ00204 248 VFPGNYVTPVS 258 SH3: domain 3 of 3, from 562 to 618: score 65.1, E = 8.6e-15 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG e+++++ +y +q+e E+ +k+GDi+ v++k++dgW++G+l+r+G++G mFLJ00204 562 ERYRVVVSYPPQSEAEIELKEGDIVFVHKKHEDGWFKGTLQRNGRTG 608 lfPsnYVeeie<-* lfP+++V e mFLJ00204 609 LFPGSFV-ESF 618 //