hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm03276/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00183 ( 416 res) mpm03276 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CYCLIN domain present in cyclins, TFIIB and Retinob 51.1 1.4e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CYCLIN 1/1 83 185 .. 1 90 [] 51.1 1.4e-10 Alignments of top-scoring domains: CYCLIN: domain 1 of 1, from 83 to 185: score 51.1, E = 1.4e-10 *->dfLrrvakalnldpetlylAvnlldrfLseykvlkgyspsliAaaal ++ + l+l++ ++++ l++rf +++++k +s++++ +a++ mFLJ00183 83 ELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVK-HSMEHVSMACV 128 ylAsKteeippwtktlfhytgylpp..............elayteeeile +lAsK+ee p+ +++ +++++ l++ ++++++ + ++e++ + +i++ mFLJ00183 129 HLASKIEEAPRRIRDVINVFHRLRHlrekkkpvplvldqEYVNLKNQIIK 178 mekllle<-* e+ +l+ mFLJ00183 179 AERRVLK 185 //