hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mph/mph00646/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00136 ( 857 res) mph00646 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TMC TMC domain 229.3 5.7e-65 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TMC 1/1 586 692 .. 1 116 [] 229.3 5.7e-65 Alignments of top-scoring domains: TMC: domain 1 of 1, from 586 to 692: score 229.3, E = 5.7e-65 *->CWETfVGQElYKLvifDFlftllvtflveFlRrllvrylsskwlWDl CWE+fVGQElY+++++DF+f+ll+++++e+++rl++++ mFLJ00136 586 CWEDFVGQELYRFMVVDFIFMLLDSLFGELVWRLISEKK-------- 624 EltflgrqEFdvarNVLeLIYgQTlvWiGiFFcPLLPaIntiKlfilFYi l++ +++EFd+arNVL+LIYgQTl+W+G++F+PLLPa++++ l++lF i mFLJ00136 625 -LKRGQKPEFDIARNVLDLIYGQTLTWLGVLFSPLLPAVQILRLLFLFHI 673 KKisLltNcrPpsrpFRAS<-* KK sL+ Nc++p+rp+ AS mFLJ00136 674 KKASLMANCQAPRRPWLAS 692 //