hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/msk/msk07274/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00127 ( 641 res) msk07274 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Kelch_1 Kelch motif 195.0 1.2e-54 5 BTB BTB/POZ domain 132.4 8.3e-36 1 Kelch_2 Kelch motif 127.6 2.3e-34 6 BACK BTB And C-terminal Kelch 103.8 3.2e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- BTB 1/1 63 170 .. 1 135 [] 132.4 8.3e-36 BACK 1/1 175 277 .. 1 103 [] 103.8 3.2e-27 Kelch_2 1/6 308 358 .. 1 54 [] 22.2 0.012 Kelch_1 1/5 360 410 .. 1 45 [] 54.6 2.2e-12 Kelch_2 2/6 360 410 .. 1 54 [] 27.3 0.00037 Kelch_1 2/5 412 457 .. 1 45 [] 42.8 7.8e-09 Kelch_2 3/6 412 457 .. 1 54 [] 21.6 0.018 Kelch_1 3/5 459 506 .. 1 45 [] 31.9 1.5e-05 Kelch_2 4/6 459 506 .. 1 54 [] 11.8 6.9 Kelch_1 4/5 508 559 .. 1 45 [] 31.7 1.7e-05 Kelch_2 5/6 508 559 .. 1 54 [] 21.4 0.022 Kelch_1 5/5 561 608 .. 1 45 [] 43.1 6.5e-09 Kelch_2 6/6 561 608 .. 1 54 [] 28.8 0.00013 Alignments of top-scoring domains: BTB: domain 1 of 1, from 63 to 170: score 132.4, E = 8.3e-36 *->lnelreqgelcDVtLvvgdgsgrydvgkkfkAHKavLaacSpYFkal lne+r++g +cDV+Lvv++ ++++AH+ La cS+YF+++ mFLJ00127 63 LNEQRLHGLFCDVVLVVEE--------QQVPAHRNLLAVCSDYFNSM 101 FtgqfkesiteeessvsseieledvspedfealLefiYtgelsitqdqks Ft + + e + e+el + s+ ++a+++f+Y++el+++ mFLJ00127 102 FTLG------MREAFQK-EVELVGTSYVGLKAVVDFLYSSELELD----- 139 PssckseenvedlLalAadllqipslvdkCeefliksl<-* +n++++L++A +llqi+ +vd C+e+l + mFLJ00127 140 ------GSNIDYILETA-HLLQIWTVVDFCCEYLEQEV 170 BACK: domain 1 of 1, from 175 to 277: score 103.8, E = 3.2e-27 *->CLgIrrfAdaygceeLaeaAdrfilqnFleVakseEFlq.LskeqLi L+++++A +y++++L ++ d+f+l++F++++ +++Flq++s+++L+ mFLJ00127 175 YLYLQELASIYSLKRLDAFIDSFVLSHFSTLSFTPDFLQsISVQKLC 221 elLssDeLnVpsEeeVfeAvmrWvkhdvenRkkhlpeLLshVRLpLLspk +Lss + + E+++++ +++W+ +++e R++h+ ++L+++R+pL +++ mFLJ00127 222 VYLSSGQVQHKWEYDLLQVALQWLTQQPE-REVHTRRVLENIRFPLFPED 270 yLlevve<-* Ll++v+ mFLJ00127 271 ILLQRVK 277 Kelch_2: domain 1 of 6, from 308 to 358: score 22.2, E = 0.012 *->pryphasvvp..ggklyvvGGsfkgnrgtgngdesssdllvldpetn p ++ ++++++++l++vGG +++++ e+s+d ++ld++ + mFLJ00127 308 PVLQTKRTLLrsEECLLFVGGE-----VSERCLELSDDTCYLDTKNE 349 vWeklpalp<-* +W k ++lp mFLJ00127 350 QWVKETSLP 358 Kelch_1: domain 1 of 5, from 360 to 410: score 54.6, E = 2.2e-12 *->pRsgagvvvldgkiYviGGydg......qslnsvevYDpetntWtkl +Rs+++v+vl+g i+++GG+ +++++++ ++n ++YDp+ ++W k+ mFLJ00127 360 RRSHHCVAVLGGFIFIAGGSFSrdnggnAASNLLYRYDPRRKQWIKV 406 psmp<-* +sm+ mFLJ00127 407 ASMN 410 Kelch_2: domain 2 of 6, from 360 to 410: score 27.3, E = 0.00037 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW +r++h ++v+gg +++ GGs + + +g+ +s+ l+++dp+ ++W mFLJ00127 360 RRSHHCVAVLGGFIFIAGGS---FSRDNGGNAASNLLYRYDPRRKQW 403 eklpalp<-* k++++ mFLJ00127 404 IKVASMN 410 Kelch_1: domain 2 of 5, from 412 to 457: score 42.8, E = 7.8e-09 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< +R+ + +++++ + ++GG++ + +l+sve Y+p+tn+Wt+++ +p mFLJ00127 412 RRVDFYLASIEDMLVAVGGRNEnGALSSVETYSPKTNSWTYVAGLP 457 -* mFLJ00127 - - Kelch_2: domain 3 of 6, from 412 to 457: score 21.6, E = 0.018 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW +r+ ++++++ l+ vGG+ n + ++s++ + p+tn+W mFLJ00127 412 RRVDFYLASIEDMLVAVGGR--------NENGALSSVETYSPKTNSW 450 eklpalp<-* +++++lp mFLJ00127 451 TYVAGLP 457 Kelch_1: domain 3 of 5, from 459 to 506: score 31.9, E = 1.5e-05 *->pRsgagvvvldgkiYviGGydg...qslnsvevYDpetntWtklpsm +g++ + +++ +Y+ GG+d + + + ++ +YD++t+ W++ +m mFLJ00127 459 FTYGHAGTIYKDFVYISGGHDYqigPYRKNLLCYDHRTDVWEERRPM 505 p<-* + mFLJ00127 506 T 506 Kelch_2: domain 4 of 6, from 459 to 506: score 11.8, E = 6.9 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW ++y+ha + + + +y++GG+ ++ +++ ll++d +t vW mFLJ00127 459 FTYGHAGTIYKDFVYISGGH------DYQIGPYRKNLLCYDHRTDVW 499 eklpalp<-* e+ ++ mFLJ00127 500 EERRPMT 506 Kelch_1: domain 4 of 5, from 508 to 559: score 31.7, E = 1.7e-05 *->pRsgagvvvldgkiYviGGydg.......qslnsvevYDpetntWtk +R +++++l++ iY iGG+d++ ++ ++ + ve+Y+p n+Wt+ mFLJ00127 508 ARGWHSMCSLGDSIYSIGGSDDhmesmerFDVLGVEAYSPQCNQWTR 554 lpsmp<-* ++++ mFLJ00127 555 VAPLL 559 Kelch_2: domain 5 of 6, from 508 to 559: score 21.4, E = 0.022 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW r+ h+++++g+ +y++GGs+++ + +++d + + p+ n+W mFLJ00127 508 ARGWHSMCSLGDSIYSIGGSDDHMESMERFDVLGVEA--YSPQCNQW 552 eklpalp<-* +++++l mFLJ00127 553 TRVAPLL 559 Kelch_1: domain 5 of 5, from 561 to 608: score 43.1, E = 6.5e-09 *->pRsgagvvvldgkiYviGGydg...qslnsvevYDpetntWtklpsm + s gv+v +g+iY+ GGy+ +++ +++ v vYD e n+W+++p++ mFLJ00127 561 ANSESGVAVWQGRIYILGGYSWestAFSRAVQVYDSEANRWSRGPDL 607 p<-* p mFLJ00127 608 P 608 Kelch_2: domain 6 of 6, from 561 to 608: score 28.8, E = 0.00013 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW + + ++v++g++y+ GG+ + + +s+ ++v+d e n+W mFLJ00127 561 ANSESGVAVWQGRIYILGGY------SWESTAFSRAVQVYDSEANRW 601 eklpalp<-* ++ p+lp mFLJ00127 602 SRGPDLP 608 //