hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mtj/mtj01003/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00120 ( 1173 res) mtj01003 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CARD Caspase recruitment domain 90.0 4.8e-23 1 PDZ PDZ domain (Also known as DHR or GLGF) 10.2 0.17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CARD 1/1 42 128 .. 1 89 [] 90.0 4.8e-23 PDZ 1/1 682 771 .. 1 82 [] 10.2 0.17 Alignments of top-scoring domains: CARD: domain 1 of 1, from 42 to 128: score 90.0, E = 4.8e-23 *->rellrknRvaLvrrlgketldglLDyLleknVLteeeyEeIkaa..n +++++ nR++L r ++ + +l++yL++++V+ e++++e+++a+ mFLJ00120 42 WDNVECNRHMLSRYIN---PAKLTPYLRQCKVIDEQDEDEVLNApmL 85 ttrrdkareLldlvqkkGpeafqiFleaLretgqphLadllels<-* ++ ++a++Lld++ +kG++++ +Fle+L++ ++p L++l++++ mFLJ00120 86 PSKINRAGRLLDILHTKGQRGYVVFLESLEF-YYPELYKLVTGK 128 PDZ: domain 1 of 1, from 682 to 771: score 10.2, E = 0.17 *->evtlekevkrgglGf..sikggsdk..givvsevlpGsgaAeagGrL +++ + +g G+ +++ + + +g ++ +v pG + Ae++G L mFLJ00120 682 GPLVQHT-TLNGDGLitQLTLLGGNarGSFIHSVKPG-SLAERAG-L 725 keGDqIlsvNG........qdvenlsheravlalkgsggsevtLtil<-* +eG+q+l + G +++++++++ + e+a+ +++++g +tL + mFLJ00120 726 REGHQLLLLEGcirgerqsVPLDACTKEEARWTIQRCSG-LITLHYK 771 //