hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mpj/mpj01066/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mFLJ00110  ( 244 res)   mpj01066

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
HLH      Helix-loop-helix DNA-binding domain             53.8    3.8e-12   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
HLH        1/1      89   141 ..     1    53 []    53.8  3.8e-12

Alignments of top-scoring domains:
HLH: domain 1 of 1, from 89 to 141: score 53.8, E = 3.8e-12
                   *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve
                       R +hn++E+ RR++++  +e+L++l+P +++s++ + ++ L++A  
   mFLJ00110    89    NRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKM 135  

                   YIksLq<-*
                   +Ik+L+   
   mFLJ00110   136 HIKKLE    141  

//