hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mid/mid34019/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00061 ( 280 res) mid34019 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1681 Protein of unknown function (DUF1681) 420.1 2.1e-122 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1681 1/1 4 190 .. 1 204 [] 420.1 2.1e-122 Alignments of top-scoring domains: DUF1681: domain 1 of 1, from 4 to 190: score 420.1, E = 2.1e-122 *->meyEsvLivvpeVvVYkIPPrastsGykAaDWdleapiWtGRLRivs eyEsvL+v+p+V+VY+IPPras++Gy+A+DW+l++p+WtGRLRi+s mFLJ00061 4 LEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITS 50 kGeacsikLEDptTGdLfAaaPidtypGtvEaaVEavsDSSRYFViRVqD kG+ ++ikLED+++G+LfA+aP+++ypG +aVE+v+DSSRYFViR+qD mFLJ00061 51 KGKIAYIKLEDKVSGELFAQAPVEQYPG---IAVETVTDSSRYFVIRIQD 97 pTnGkkAFIGlGFqERseAFDFnVALqDHfKylkrkaevekGelikssqk + +G++AFIG+GF +R++AFDFnV LqDHfK++k++ e++k +sq+ mFLJ00061 98 G-TGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISK-----ESQE 141 qqaepklDlsLKEGETIkiNLgkkkkkdggrpsvppggdlGsgsppplsa ++++pklDl++KEG+TIk+ +g+++ k+gg+ +++++g+ g++ mFLJ00061 142 MDNRPKLDLGFKEGQTIKLSIGNITAKKGGASKPRASGTG--GLS----- 184 flLPPPP<-* lLPPPP mFLJ00061 185 -LLPPPP 190 //