hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm09196/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00040 ( 638 res) mpm09196 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 222.5 3.6e-62 8 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/8 92 121 .. 1 30 [] 31.1 0.00015 ANK 2/8 125 154 .. 1 30 [] 23.4 0.031 ANK 3/8 158 188 .. 1 30 [] 29.6 0.00042 ANK 4/8 194 223 .. 1 30 [] 28.2 0.0011 ANK 5/8 332 364 .. 1 30 [] 24.5 0.015 ANK 6/8 365 394 .. 1 30 [] 25.0 0.01 ANK 7/8 398 427 .. 1 30 [] 38.7 7.7e-07 ANK 8/8 431 460 .. 1 30 [] 29.4 0.00051 Alignments of top-scoring domains: ANK: domain 1 of 8, from 92 to 121: score 31.1, E = 0.00015 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+TpLH+Aa g+ +++ +L++kga +na mFLJ00040 92 RGQTPLHVAALCGQASLIDFLVSKGAVVNA 121 ANK: domain 2 of 8, from 125 to 154: score 23.4, E = 0.031 *->dGrTpLHlAaengnlevvklLldkgadina<-* +G TpLHlA+++g +v lLl ++a+ ++ mFLJ00040 125 HGSTPLHLACQKGFQSVTLLLLHYKASTEV 154 ANK: domain 3 of 8, from 158 to 188: score 29.6, E = 0.00042 *->dGrTpLHlAaengnlevvklLldkga.dina<-* +G+TpLHlA+ +g++++vk+L+ ++++ + + mFLJ00040 158 NGNTPLHLACTYGQEDCVKALVYYDVqACRL 188 ANK: domain 4 of 8, from 194 to 223: score 28.2, E = 0.0011 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+T+LH+Aa++g++ +++ Ll++ga + mFLJ00040 194 KGDTALHIAARWGYEGIIETLLQNGAPTAV 223 ANK: domain 5 of 8, from 332 to 364: score 24.5, E = 0.015 *->dGrTpLHlAaengnlevvklLldkga...dina<-* dG++pLH+Aa +g+ ++v lLl++ga ++ n mFLJ00040 332 DGFSPLHMAALHGRTDLVPLLLKHGAysgARNT 364 ANK: domain 6 of 8, from 365 to 394: score 25.0, E = 0.01 *->dGrTpLHlAaengnlevvklLldkgadina<-* pLHlA++ g+ v+k+Lld++a +n+ mFLJ00040 365 SQAVPLHLACQQGHFQVAKCLLDSNAKPNK 394 ANK: domain 7 of 8, from 398 to 427: score 38.7, E = 7.7e-07 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+TpL +A++ g++ev+ lLl++ga+ina mFLJ00040 398 SGNTPLICACSAGHHEVAALLLQHGASINA 427 ANK: domain 8 of 8, from 431 to 460: score 29.4, E = 0.00051 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+T+LH A++ + vv+lLl +ga++++ mFLJ00040 431 KGNTALHEAVMGRHTLVVELLLFYGASVDI 460 //