>>>mFLJ00002 ( 1486 res) mbg13511 >ATP_GTP_A2_1 8.651 881 pos. 628 - 650 PS50101|ATP_GTP_A2 P-loop nucleotide binding motif (does not find all). LVGIVGKVGCGKSSLLAAITGEL >ATP_GTP_A2_2 8.896 898 pos. 1269 - 1294 PS50101|ATP_GTP_A2 P-loop nucleotide binding motif (does not find all). KLGIVGRTGSGKSSLFLVLFRLLEPN >DA_BOX_1 15.774 853 pos. 726 - 797 PS50100|DA_BOX 2nd half motif for nucleotide binding, associated with P-loop. LSGGQRARIALARAVYQEKALYLLDDPLAAVDADVANHLLHRCILGVLSHTTRLLCTHRT EYLERADVVLLM >DA_BOX_2 17.367 941 pos. 1376 - 1446 PS50100|DA_BOX 2nd half motif for nucleotide binding, associated with P-loop. LSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRLN TILNSDRVLVL