hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg13511/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mFLJ00002 ( 1486 res) mbg13511 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- AAA ATPases associated with a variety of cellula 97.2 1.9e-24 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- AAA 1/2 625 808 .. 1 92 [] 40.3 2.6e-07 AAA 2/2 1266 1450 .. 1 92 [] 58.7 7.3e-13 Alignments of top-scoring domains: AAA: domain 1 of 2, from 625 to 808: score 40.3, E = 2.6e-07 *->pgevvllvGppGsGKTTlaralarllgp.....gviyidge...... +g v++vG G+GK+ l++a+ ++l + + v +++ + + mFLJ00002 625 KGMLVGIVGKVGCGKSSLLAAITGELHRlcgwvAVSELSKGfglatq 671 .................................................. + + +++ ++ + + ++ + +++ + +++ + ++ mFLJ00002 672 epwiqcatirdnilfgktfdaqlyrevleacalnddlsilpagdqtevge 721 ......ggqrirlalalark...dvlllDEitslld.............. ++ +ggqr+r+ala+a ++ + ++llD++ ++ d + ++++++ ++ mFLJ00002 722 kgvtlsGGQRARIALARAVYqekALYLLDDPLAAVDadvanhllhrcilg 771 .....vtviattn...dldpallrrrfdrrivllril<-* +++ +++++t+ ++ ++ +++ ++ ++v + mFLJ00002 772 vlshtTRLLCTHRteyLERADVVLLMEAGQLVRTGPP 808 AAA: domain 2 of 2, from 1266 to 1450: score 58.7, E = 7.3e-13 *->pgevvllvGppGsGKTTlaralarllgp...gviyidge........ pge++++vG++GsGK+ l + l rll+p+ ++v++ + + ++ + + mFLJ00002 1266 PGEKLGIVGRTGSGKSSLFLVLFRLLEPnagRVLLDNVDtsqlelae 1312 .................................................. +++ ++ ++ +++ + ++ ++++ + ++ + ++ mFLJ00002 1313 lrsqlavipqepflfsgtirenldpqglhedralwqaleqchlsevavam 1362 .............ggqrirlalalark.....dvlllDEitslld..... ++ +++ ++++++ ++r++l lar+ ++ ++l +DE+t+ d++ ++ mFLJ00002 1363 ggldgelgergqnLSLGQRQLLCLARAlltdaKILCIDEATASVDqktdq 1412 ............vtviattndldpallrrrfdrrivllril<-* ++++ ++ ++tv+ +++ ++++++ +dr++vl ++ mFLJ00002 1413 llqqtickrfanKTVLTIAH---RLNTILNSDRVLVLQAGR 1450 //