Human ORFeome
Gene/Protein Characteristic Table for ORH29295P
Order ORFeome clone(s) from : Japan || Other countries
Check our QC before Ordering.
Product ID ORH29295P
Clone name on22406
IMAGE Clone ID 100071813
Vector name pENTR223
Stop codon without
Genbank Acc HQ448386
Parent Genbank Acc BC069423.1
Parent gene symbol DEFA1
Description Homo sapiens defensin, alpha 1, mRNA (cDNA clone MGC:97418 IMAGE:7262694), complete cds.
The cloned ORF sequence

Download
Length: 282 bp
ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAG
CCACTCCAGGCAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATC
CCAGAAGTGGTTGTTTCCCTTGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCA
AGGAAAAACATGGCCTGCTATTGCAGAATACCAGCGTGCATTGCAGGAGAACGTCGCTAT
GGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGC

The protein sequence

Download
Length: 94 aa
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Order ORFeome clone(s) from Japan || Other countries
Send a message to office AT kazusa.or.jp