Miyakogusa Predicted Gene
- Lj4g3v2139600.1
BLASTP 2.2.25 [Feb-01-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Lj4g3v2139600.1 Non Chatacterized Hit- tr|C6THQ8|C6THQ8_SOYBN
Putative uncharacterized protein (Fragment)
OS=Glycine,58.33,2e-18,Lissencephaly type-1-like homology motif,LisH
dimerisation motif; LISH,LisH dimerisation motif;
seg,,NODE_56480_length_408_cov_67.357841.path1.1
(114 letters)
Database: TAIR10_pep
35,386 sequences; 14,482,855 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT5G57120.1 | Symbols: | FUNCTIONS IN: molecular_function unkno... 45 8e-06
>AT5G57120.1 | Symbols: | FUNCTIONS IN: molecular_function unknown;
INVOLVED IN: biological_process unknown; LOCATED IN:
nucleolus; EXPRESSED IN: 21 plant structures; EXPRESSED
DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
LisH dimerisation motif (InterPro:IPR006594), SRP40,
C-terminal (InterPro:IPR007718); Has 101969 Blast hits
to 55488 proteins in 2506 species: Archae - 424;
Bacteria - 13843; Metazoa - 37674; Fungi - 9726; Plants
- 4941; Viruses - 569; Other Eukaryotes - 34792 (source:
NCBI BLink). | chr5:23122767-23124400 REVERSE LENGTH=330
Length = 330
Score = 45.4 bits (106), Expect = 8e-06, Method: Compositional matrix adjust.
Identities = 24/57 (42%), Positives = 36/57 (63%)
Query: 52 QSIARYFDRRGLSKSLKKFRSEAKIEKDNVDESSVDLEELFLKYLETCSQDVKSNVN 108
+S+A+Y +R G SK KK SEA+IEK ++ S DLEE+F ++L + +N N
Sbjct: 20 RSVAQYLERCGFSKCFKKLLSEAEIEKKELNTSLPDLEEIFSEFLNKRDHEAAANGN 76