Miyakogusa Predicted Gene
- Lj3g3v1061480.1
BLASTP 2.2.25 [Feb-01-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Lj3g3v1061480.1 Non Chatacterized Hit- tr|I1LV74|I1LV74_SOYBN
Uncharacterized protein OS=Glycine max PE=4 SV=1,68.12,4e-18,
,CUFF.42105.1
(69 letters)
Database: TAIR10_pep
35,386 sequences; 14,482,855 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT1G16916.1 | Symbols: | unknown protein; FUNCTIONS IN: molecul... 54 2e-08
>AT1G16916.1 | Symbols: | unknown protein; FUNCTIONS IN:
molecular_function unknown; INVOLVED IN:
biological_process unknown; LOCATED IN:
cellular_component unknown; Has 30201 Blast hits to
17322 proteins in 780 species: Archae - 12; Bacteria -
1396; Metazoa - 17338; Fungi - 3422; Plants - 5037;
Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
BLink). | chr1:5786762-5787047 REVERSE LENGTH=65
Length = 65
Score = 54.3 bits (129), Expect = 2e-08, Method: Compositional matrix adjust.
Identities = 18/40 (45%), Positives = 30/40 (75%)
Query: 8 GPAGPKLVRLIWFVGAAVICTMGTNKWLEYEKKTIIQQQQ 47
GP PK++R+++FVGA +CT NKW E E+ ++++Q+Q
Sbjct: 5 GPPAPKMLRMVYFVGAGFLCTFAINKWREMERNSLLKQEQ 44