Miyakogusa Predicted Gene
- Lj1g3v4144840.3
BLASTP 2.2.25 [Feb-01-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= Lj1g3v4144840.3 Non Chatacterized Hit- tr|C6SWB5|C6SWB5_SOYBN
Uncharacterized protein OS=Glycine max GN=Gma.53426 PE,52,1e-18,
,CUFF.32011.3
(113 letters)
Database: TAIR10_pep
35,386 sequences; 14,482,855 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AT2G41200.1 | Symbols: | unknown protein; Has 26 Blast hits to ... 54 2e-08
>AT2G41200.1 | Symbols: | unknown protein; Has 26 Blast hits to 26
proteins in 11 species: Archae - 0; Bacteria - 0;
Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other
Eukaryotes - 0 (source: NCBI BLink). |
chr2:17171657-17172929 FORWARD LENGTH=161
Length = 161
Score = 53.9 bits (128), Expect = 2e-08, Method: Compositional matrix adjust.
Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 2/67 (2%)
Query: 37 DATINFPEFYRGVCEIVEELNEKRGNTQFKLPETEVLKKAYKYNENHKGKDKALKKSEFK 96
D +F +FYR V E VEE+N + G TQ K+P E L++AY+ ++ G+ K L K EF+
Sbjct: 37 DQEWSFGDFYRIVAEAVEEINRRLGGTQLKVPSVEKLQQAYEI--HNLGQGKKLSKDEFQ 94
Query: 97 EIMKEMV 103
++++E++
Sbjct: 95 KLLQEVL 101