hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/smart.HMMs.bin Sequence file: /tmp/20090424/iprscan-20090424-16454562/chunk_1/iprscan-20090424-16454562.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pF1KB7668 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00132 149.9 2.7e-40 2 SM00389 90.6 1.9e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00132 1/2 4 55 .. 1 52 [] 73.7 2.4e-17 SM00132 2/2 63 118 .. 1 52 [] 76.2 4e-18 SM00389 1/1 180 242 .. 1 63 [] 90.6 1.9e-22 Alignments of top-scoring domains: SM00132: domain 1 of 2, from 4 to 55: score 73.7, E = 2.4e-17 *->kCagCgkpItgdevlralgkvwHpeCFkCskCkkpLggtffekdgkl +CagC +pI +++ l++l+++wH +C +C++Ck++L++++f+++gkl pF1KB7668 4 HCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKL 50 yCkdc<-* yCk++ pF1KB7668 51 YCKND 55 SM00132: domain 2 of 2, from 63 to 118: score 76.2, E = 4e-18 *->kCagCgkpItg.devlralgkvwHpeCFkCskCkkpLgg...tffek kCagC ++I+++d v++a+ kv+H +CF+C +C+k+L+++++ ++ + pF1KB7668 63 KCAGCAQGISPsDLVRKARSKVFHLNCFTCMVCNKQLSTgeeLYVID 109 dgklyCkdc<-* ++k+ Ckd+ pF1KB7668 110 ENKFVCKDD 118 SM00389: domain 1 of 1, from 180 to 242: score 90.6, E = 1.9e-22 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv +r +Rt++ Qle+L+++F+ +p+P+r+ re+LA+e+gL r+++v pF1KB7668 180 RRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQV 226 WFQNRRakwkrqekkk<-* WFQNRR k++r+++ + pF1KB7668 227 WFQNRRSKERRMKQLS 242 //