hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/smart.HMMs.bin Sequence file: /tmp/20080627/iprscan-20080627-01225248/chunk_1/iprscan-20080627-01225248.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pF1KB7689 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00348 218.2 7.4e-61 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00348 1/1 1 114 [. 1 118 [] 218.2 7.4e-61 Alignments of top-scoring domains: SM00348: domain 1 of 1, from 1 to 114: score 218.2, E = 7.4e-61 *->maerrmrLrpWLveqveSgqYPGHLcWlDeEKTrFRIPWkHaarsdf m+++rmr+rpWL+eq++S+++PG L Wl++EK++F+IPW+Haar+++ pF1KB7689 1 MPVERMRMRPWLEEQINSNTIPG-LKWLNKEKKIFQIPWMHAARHGW 46 deeeDaeiFkawavarGiyqpggrspdpkeckkWkarlrcAlrksrdfee d e+Da +F+ wa+++G+ qpg+++pdp k+Wka++rcA+++++d+ee pF1KB7689 47 DVEKDAPLFRNWAIHTGKHQPGVDKPDP---KTWKANFRCAMNSLPDIEE 93 ikdrsrddppdpykVyrLlpe<-* +kd s ++++++++Vyr+lp pF1KB7689 94 VKDKSIKKGNNAFRVYRMLPL 114 //