hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data/smart.HMMs.bin
Sequence file:            /tmp/20080306/iprscan-20080306-06460036/chunk_1/iprscan-20080306-06460036.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pF1KSDA1052
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00456                                                  30.5    0.00023   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00456    1/1      57    89 ..     1    34 []    30.5  0.00023

Alignments of top-scoring domains:
SM00456: domain 1 of 1, from 57 to 89: score 30.5, E = 0.00023
                   *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-*
                      plP+ W+   d   G +YY+N  ++++ W++P +   
  pF1KSDA105    57    PLPGEWKPCQDIT-GDIYYFNFANGQSMWDHPCD    89   

//