Result of FASTA (omim) for pFN21AE6169
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6169, 63 aa
  1>>>pF1KE6169 63 - 63 aa - 63 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.2922+/-0.000327; mu= 10.0018+/- 0.020
 mean_var=33.5770+/- 6.813, 0's: 0 Z-trim(113.1): 10  B-trim: 1058 in 1/50
 Lambda= 0.221337
 statistics sampled from 22347 (22355) to 22347 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.671), E-opt: 0.2 (0.262), width:  16
 Scan time:  2.920

The best scores are:                                      opt bits E(85289)
NP_037519 (OMIM: 610843) cytochrome b-c1 complex s (  63)  407 135.8 4.4e-33
NP_001003684 (OMIM: 610843) cytochrome b-c1 comple (  62)  311 105.2 7.4e-24


>>NP_037519 (OMIM: 610843) cytochrome b-c1 complex subun  (63 aa)
 initn: 407 init1: 407 opt: 407  Z-score: 714.9  bits: 135.8 E(85289): 4.4e-33
Smith-Waterman score: 407; 100.0% identity (100.0% similar) in 63 aa overlap (1-63:1-63)

               10        20        30        40        50        60
pF1KE6 MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_037 MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
               10        20        30        40        50        60

          
pF1KE6 ENK
       :::
NP_037 ENK
          

>>NP_001003684 (OMIM: 610843) cytochrome b-c1 complex su  (62 aa)
 initn: 311 init1: 311 opt: 311  Z-score: 549.3  bits: 105.2 E(85289): 7.4e-24
Smith-Waterman score: 311; 100.0% identity (100.0% similar) in 50 aa overlap (1-50:1-50)

               10        20        30        40        50        60
pF1KE6 MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
       ::::::::::::::::::::::::::::::::::::::::::::::::::          
NP_001 MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGVRACAIPDLG
               10        20        30        40        50        60

          
pF1KE6 ENK
          
NP_001 PA 
          




63 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:02:10 2016 done: Tue Nov  8 10:02:11 2016
 Total Scan time:  2.920 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com