FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6172, 82 aa
  1>>>pF1KE6172 82 - 82 aa - 82 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5683+/-0.000318; mu= 10.9890+/- 0.019
 mean_var=44.7634+/- 9.446, 0's: 0 Z-trim(115.3): 13  B-trim: 584 in 1/54
 Lambda= 0.191696
 statistics sampled from 25703 (25716) to 25703 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.712), E-opt: 0.2 (0.302), width:  16
 Scan time:  2.310

The best scores are:                                      opt bits E(85289)
NP_055217 (OMIM: 612080,615159) cytochrome b-c1 co (  82)  556 160.4 2.9e-40


>>NP_055217 (OMIM: 612080,615159) cytochrome b-c1 comple  (82 aa)
 initn: 556 init1: 556 opt: 556  Z-score: 843.9  bits: 160.4 E(85289): 2.9e-40
Smith-Waterman score: 556; 100.0% identity (100.0% similar) in 82 aa overlap (1-82:1-82)

               10        20        30        40        50        60
pF1KE6 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_055 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
               10        20        30        40        50        60

               70        80  
pF1KE6 TWGTEEFERSKRKNPAAYENDK
       ::::::::::::::::::::::
NP_055 TWGTEEFERSKRKNPAAYENDK
               70        80  




82 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:03:42 2016 done: Tue Nov  8 10:03:43 2016
 Total Scan time:  2.310 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]