FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2250, 170 aa 1>>>pF1KE2250 170 - 170 aa - 170 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3669+/-0.000307; mu= 17.3659+/- 0.019 mean_var=55.8097+/-11.185, 0's: 0 Z-trim(116.3): 112 B-trim: 58 in 1/51 Lambda= 0.171680 statistics sampled from 27158 (27284) to 27158 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.73), E-opt: 0.2 (0.32), width: 16 Scan time: 5.530 The best scores are: opt bits E(85289) NP_003333 (OMIM: 601569) ubiquitin-conjugating enz ( 170) 1169 297.0 9.8e-81 NP_060281 (OMIM: 612506) ubiquitin-conjugating enz ( 238) 610 158.6 6e-39 NP_003334 (OMIM: 603124) ubiquitin-conjugating enz ( 165) 587 152.8 2.4e-37 XP_006723015 (OMIM: 116948) PREDICTED: ubiquitin-c ( 179) 581 151.4 7.1e-37 NP_004350 (OMIM: 116948) ubiquitin-conjugating enz ( 236) 579 151.0 1.2e-36 XP_005259747 (OMIM: 116948) PREDICTED: ubiquitin-c ( 269) 576 150.3 2.3e-36 NP_872630 (OMIM: 603124) ubiquitin-conjugating enz ( 137) 539 140.9 7.8e-34 XP_016883958 (OMIM: 603124) PREDICTED: ubiquitin-c ( 137) 539 140.9 7.8e-34 XP_011516251 (OMIM: 612506) PREDICTED: ubiquitin-c ( 193) 493 129.6 2.7e-30 NP_001189418 (OMIM: 603124) ubiquitin-conjugating ( 95) 360 96.4 1.3e-20 NP_003329 (OMIM: 602961) ubiquitin-conjugating enz ( 147) 318 86.2 2.5e-17 NP_871622 (OMIM: 602963) ubiquitin-conjugating enz ( 149) 301 81.9 4.6e-16 NP_871620 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871619 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871617 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_003331 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871618 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871616 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871615 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 298 81.2 7.7e-16 NP_871621 (OMIM: 602963) ubiquitin-conjugating enz ( 148) 298 81.2 7.7e-16 NP_003330 (OMIM: 602962) ubiquitin-conjugating enz ( 147) 297 80.9 9.1e-16 XP_016865309 (OMIM: 602962) PREDICTED: ubiquitin-c ( 173) 292 79.8 2.4e-15 NP_001265484 (OMIM: 604151) ubiquitin-conjugating ( 207) 281 77.1 1.8e-14 NP_006348 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 281 77.1 1.8e-14 NP_001265483 (OMIM: 604151) ubiquitin-conjugating ( 207) 281 77.1 1.8e-14 XP_005246301 (OMIM: 604151) PREDICTED: ubiquitin-c ( 207) 281 77.1 1.8e-14 NP_872619 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 281 77.1 1.8e-14 XP_005265490 (OMIM: 602163) PREDICTED: ubiquitin-c ( 189) 280 76.8 2e-14 NP_689866 (OMIM: 602163) ubiquitin-conjugating enz ( 201) 280 76.9 2.1e-14 XP_005265489 (OMIM: 602163) PREDICTED: ubiquitin-c ( 201) 280 76.9 2.1e-14 NP_003332 (OMIM: 602916) ubiquitin-conjugating enz ( 193) 270 74.4 1.2e-13 NP_001189405 (OMIM: 602916) ubiquitin-conjugating ( 160) 266 73.3 2e-13 XP_005265488 (OMIM: 602916) PREDICTED: ubiquitin-c ( 167) 266 73.3 2.1e-13 XP_005251553 (OMIM: 612506) PREDICTED: ubiquitin-c ( 209) 262 72.4 4.8e-13 NP_054895 (OMIM: 610538,616435) ubiquitin-conjugat ( 197) 256 70.9 1.3e-12 NP_001287724 (OMIM: 602963) ubiquitin-conjugating ( 118) 252 69.7 1.8e-12 NP_862821 (OMIM: 602962) ubiquitin-conjugating enz ( 118) 252 69.7 1.8e-12 XP_016864073 (OMIM: 602963) PREDICTED: ubiquitin-c ( 118) 252 69.7 1.8e-12 NP_003339 (OMIM: 603679) ubiquitin-conjugating enz ( 152) 253 70.1 1.8e-12 XP_016884424 (OMIM: 603721) PREDICTED: ubiquitin-c ( 121) 249 69.0 3e-12 NP_003338 (OMIM: 603721) ubiquitin-conjugating enz ( 154) 249 69.1 3.6e-12 NP_001243284 (OMIM: 603721) ubiquitin-conjugating ( 212) 243 67.7 1.3e-11 XP_016872098 (OMIM: 602961) PREDICTED: ubiquitin-c ( 110) 239 66.5 1.6e-11 NP_872607 (OMIM: 602916) ubiquitin-conjugating enz ( 176) 241 67.1 1.6e-11 NP_003327 (OMIM: 300860,312180) ubiquitin-conjugat ( 152) 239 66.6 2e-11 XP_011525054 (OMIM: 610309) PREDICTED: ubiquitin-c ( 162) 238 66.4 2.5e-11 NP_003328 (OMIM: 179095) ubiquitin-conjugating enz ( 152) 237 66.1 2.8e-11 NP_001104582 (OMIM: 602846) ubiquitin-conjugating ( 157) 237 66.1 2.9e-11 NP_055316 (OMIM: 610309) ubiquitin-conjugating enz ( 222) 238 66.5 3.1e-11 NP_075567 (OMIM: 611362) ubiquitin-conjugating enz ( 354) 240 67.1 3.1e-11 >>NP_003333 (OMIM: 601569) ubiquitin-conjugating enzyme (170 aa) initn: 1169 init1: 1169 opt: 1169 Z-score: 1570.4 bits: 297.0 E(85289): 9.8e-81 Smith-Waterman score: 1169; 100.0% identity (100.0% similar) in 170 aa overlap (1-170:1-170) 10 20 30 40 50 60 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE :::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE 130 140 150 160 170 >>NP_060281 (OMIM: 612506) ubiquitin-conjugating enzyme (238 aa) initn: 596 init1: 556 opt: 610 Z-score: 820.2 bits: 158.6 E(85289): 6e-39 Smith-Waterman score: 610; 53.0% identity (77.1% similar) in 166 aa overlap (1-163:6-167) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVF :: :.::.: .: :...::::: :.:..::: ::: :.:::.:::::: : NP_060 MAQQQMTSSQKALML--ELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYF 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 KAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIH :::. :: ::: :: ..:.:..::::. .:::::::::: : .: . : : ::: : . NP_060 KAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQ 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 TVETIMISVISMLADPNGDSPANVDAA---KEWREDRNGEFKRKVARCVRKSQETAFE .:.::..::::.: .:: :::::::. ..::.... . .. :. .:: NP_060 NVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKD--KEYAEIIRKQVSATKAEA 120 130 140 150 160 170 NP_060 EKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNE 180 190 200 210 220 230 >>NP_003334 (OMIM: 603124) ubiquitin-conjugating enzyme (165 aa) initn: 568 init1: 568 opt: 587 Z-score: 791.5 bits: 152.8 E(85289): 2.4e-37 Smith-Waterman score: 587; 53.2% identity (78.5% similar) in 158 aa overlap (10-164:6-162) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAE---LNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKA :.: .:: :. :: ::. :: ........::.::.:: :: .: ::: : NP_003 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPA 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 HLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTV :.:: :::: ::::.: :..:::. .: ::::::: ::.: .:::. ::: :...: NP_003 ILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSV 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 ETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE : :..::.::::.:: .: :::::.: ::.::. .: . . . :.:: NP_003 EKILLSVVSMLAEPNDESGANVDASKMWRDDRE-QFYKIAKQIVQKSLGL 120 130 140 150 160 >>XP_006723015 (OMIM: 116948) PREDICTED: ubiquitin-conju (179 aa) initn: 576 init1: 536 opt: 581 Z-score: 783.0 bits: 151.4 E(85289): 7.1e-37 Smith-Waterman score: 581; 52.1% identity (77.3% similar) in 163 aa overlap (5-164:10-168) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVF :.:::: .: :...::::: . :.:..::: ::: :.:::.: :::: : XP_006 MARPLVPSSQKALLL--ELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYF 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 KAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIH ::.: :: ::: :: ..:.:..::::. ..::::::::: : .: . : : ::: : . XP_006 KARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQ 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 TVETIMISVISMLADPNGDSPANVDAA---KEWREDRNGEFKRKVARCVRKSQETAFE .:.::..::::.: .:: :::::::. ..:.:... . :. . .:.: XP_006 NVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKD--REYTDIIRRSWGPRWTRS 120 130 140 150 160 170 XP_006 VTA >>NP_004350 (OMIM: 116948) ubiquitin-conjugating enzyme (236 aa) initn: 576 init1: 536 opt: 579 Z-score: 778.7 bits: 151.0 E(85289): 1.2e-36 Smith-Waterman score: 579; 52.5% identity (77.2% similar) in 162 aa overlap (5-163:10-167) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVF :.:::: .: :...::::: . :.:..::: ::: :.:::.: :::: : NP_004 MARPLVPSSQKALLL--ELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYF 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 KAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIH ::.: :: ::: :: ..:.:..::::. ..::::::::: : .: . : : ::: : . NP_004 KARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQ 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 TVETIMISVISMLADPNGDSPANVDAA---KEWREDRNGEFKRKVARCVRKSQETAFE .:.::..::::.: .:: :::::::. ..:.:... . :. . .:: NP_004 NVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKD--REYTDIIRKQVLGTKVDA 120 130 140 150 160 170 NP_004 ERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES 180 190 200 210 220 230 >>XP_005259747 (OMIM: 116948) PREDICTED: ubiquitin-conju (269 aa) initn: 560 init1: 560 opt: 576 Z-score: 774.0 bits: 150.3 E(85289): 2.3e-36 Smith-Waterman score: 576; 52.1% identity (77.0% similar) in 165 aa overlap (5-166:10-169) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVF :.:::: .: :...::::: . :.:..::: ::: :.:::.: :::: : XP_005 MARPLVPSSQKALLL--ELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYF 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 KAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIH ::.: :: ::: :: ..:.:..::::. ..::::::::: : .: . : : ::: : . XP_005 KARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQ 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 TVETIMISVISMLADPNGDSPANVDAA---KEWREDRNGEFKRKVARCVRKSQETAFE .:.::..::::.: .:: :::::::. ..:.:... . :. . .: .:: XP_005 NVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKD--REYTDIIR-TQEHPGHLP 120 130 140 150 160 170 XP_005 SCTRWYLVSWGHLGAASWCWAVSALSSHGGRAPCGLLGSGLQAPAGLWRSQGSCPGRPSG 180 190 200 210 220 230 >>NP_872630 (OMIM: 603124) ubiquitin-conjugating enzyme (137 aa) initn: 528 init1: 528 opt: 539 Z-score: 728.4 bits: 140.9 E(85289): 7.8e-34 Smith-Waterman score: 539; 54.1% identity (80.7% similar) in 135 aa overlap (30-164:1-134) 10 20 30 40 50 60 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT ........::.::.:: :: .: ::: : :. NP_872 MNEENFFEWEALIMGPEDTCFEFGVFPAILS 10 20 30 70 80 90 100 110 120 pF1KE2 FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI :: :::: ::::.: :..:::. .: ::::::: ::.: .:::. ::: :...:: : NP_872 FPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKI 40 50 60 70 80 90 130 140 150 160 170 pF1KE2 MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE ..::.::::.:: .: :::::.: ::.::. .: . . . :.:: NP_872 LLSVVSMLAEPNDESGANVDASKMWRDDRE-QFYKIAKQIVQKSLGL 100 110 120 130 >>XP_016883958 (OMIM: 603124) PREDICTED: ubiquitin-conju (137 aa) initn: 528 init1: 528 opt: 539 Z-score: 728.4 bits: 140.9 E(85289): 7.8e-34 Smith-Waterman score: 539; 54.1% identity (80.7% similar) in 135 aa overlap (30-164:1-134) 10 20 30 40 50 60 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT ........::.::.:: :: .: ::: : :. XP_016 MNEENFFEWEALIMGPEDTCFEFGVFPAILS 10 20 30 70 80 90 100 110 120 pF1KE2 FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI :: :::: ::::.: :..:::. .: ::::::: ::.: .:::. ::: :...:: : XP_016 FPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKI 40 50 60 70 80 90 130 140 150 160 170 pF1KE2 MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE ..::.::::.:: .: :::::.: ::.::. .: . . . :.:: XP_016 LLSVVSMLAEPNDESGANVDASKMWRDDRE-QFYKIAKQIVQKSLGL 100 110 120 130 >>XP_011516251 (OMIM: 612506) PREDICTED: ubiquitin-conju (193 aa) initn: 495 init1: 456 opt: 493 Z-score: 664.8 bits: 129.6 E(85289): 2.7e-30 Smith-Waterman score: 493; 52.6% identity (75.2% similar) in 133 aa overlap (1-133:6-135) 10 20 30 40 50 pF1KE2 MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVF :: :.::.: .: :...::::: :.:..::: ::: :.:::.:::::: : XP_011 MAQQQMTSSQKALML--ELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYF 10 20 30 40 50 60 70 80 90 100 110 pF1KE2 KAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIH :::. :: ::: :: ..:.:..::::. .:::::::::: : .: . : : ::: : . XP_011 KAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQ 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE2 TVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE .:. ..:. . :. .: XP_011 NVRK-QVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEE 120 130 140 150 160 170 >>NP_001189418 (OMIM: 603124) ubiquitin-conjugating enzy (95 aa) initn: 349 init1: 349 opt: 360 Z-score: 490.9 bits: 96.4 E(85289): 1.3e-20 Smith-Waterman score: 360; 53.8% identity (79.6% similar) in 93 aa overlap (72-164:1-92) 50 60 70 80 90 100 pF1KE2 IIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDK :.: :..:::. .: ::::::: ::.: NP_001 MRFTCEMFHPNIYPDGRVCISILHAPGDDP 10 20 30 110 120 130 140 150 160 pF1KE2 YGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCV .:::. ::: :...:: :..::.::::.:: .: :::::.: ::.::. .: . . . : NP_001 MGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDRE-QFYKIAKQIV 40 50 60 70 80 170 pF1KE2 RKSQETAFE .:: NP_001 QKSLGL 90 170 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 12:17:41 2016 done: Sun Nov 6 12:17:41 2016 Total Scan time: 5.530 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]