FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6186, 168 aa 1>>>pF1KE6186 168 - 168 aa - 168 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6254+/-0.000763; mu= 10.8862+/- 0.046 mean_var=61.1566+/-12.685, 0's: 0 Z-trim(108.2): 13 B-trim: 248 in 1/50 Lambda= 0.164003 statistics sampled from 10027 (10032) to 10027 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.678), E-opt: 0.2 (0.308), width: 16 Scan time: 1.270 The best scores are: opt bits E(32554) CCDS12058.1 ATP5D gene_id:513|Hs108|chr19 ( 168) 1035 252.8 7.3e-68 >>CCDS12058.1 ATP5D gene_id:513|Hs108|chr19 (168 aa) initn: 1035 init1: 1035 opt: 1035 Z-score: 1331.9 bits: 252.8 E(32554): 7.3e-68 Smith-Waterman score: 1035; 100.0% identity (100.0% similar) in 168 aa overlap (1-168:1-168) 10 20 30 40 50 60 pF1KE6 MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV 70 80 90 100 110 120 130 140 150 160 pF1KE6 TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE :::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE 130 140 150 160 168 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:10:54 2016 done: Tue Nov 8 10:10:55 2016 Total Scan time: 1.270 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]