FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6594, 72 aa 1>>>pF1KE6594 72 - 72 aa - 72 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8760+/-0.000215; mu= 10.1512+/- 0.014 mean_var=56.5251+/-11.127, 0's: 0 Z-trim(124.8): 2 B-trim: 0 in 0/53 Lambda= 0.170590 statistics sampled from 47059 (47061) to 47059 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.87), E-opt: 0.2 (0.552), width: 16 Scan time: 2.670 The best scores are: opt bits E(85289) NP_892016 (OMIM: 616855) cytochrome c oxidase subu ( 72) 492 127.5 1.9e-30 NP_004065 (OMIM: 123870) cytochrome c oxidase subu ( 69) 137 40.1 0.00036 >>NP_892016 (OMIM: 616855) cytochrome c oxidase subunit (72 aa) initn: 492 init1: 492 opt: 492 Z-score: 667.8 bits: 127.5 E(85289): 1.9e-30 Smith-Waterman score: 492; 100.0% identity (100.0% similar) in 72 aa overlap (1-72:1-72) 10 20 30 40 50 60 pF1KE6 MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_892 MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA 10 20 30 40 50 60 70 pF1KE6 YVLGNLKQFRRN :::::::::::: NP_892 YVLGNLKQFRRN 70 >>NP_004065 (OMIM: 123870) cytochrome c oxidase subunit (69 aa) initn: 141 init1: 125 opt: 137 Z-score: 195.9 bits: 40.1 E(85289): 0.00036 Smith-Waterman score: 137; 46.9% identity (75.5% similar) in 49 aa overlap (24-71:20-67) 10 20 30 40 50 pF1KE6 MPLLRGRCPARRHYRRLALLGLQPAPRFA-HSGPPRQRPLSAAEMAVGLVVFFTTFLTPA :.:: :: ::. . :. :.::::. :.::: :: NP_004 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGK-LGIMELAVGLTSCFVTFLLPA 10 20 30 40 50 60 70 pF1KE6 AYVLGNLKQFRRN ...:..:. .:: NP_004 GWILSHLETYRRPE 60 72 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:39:37 2016 done: Tue Nov 8 14:39:37 2016 Total Scan time: 2.670 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]