FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6194, 69 aa 1>>>pF1KE6194 69 - 69 aa - 69 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.6698+/-0.000229; mu= 9.9735+/- 0.014 mean_var=48.6632+/- 9.620, 0's: 0 Z-trim(123.3): 5 B-trim: 0 in 0/53 Lambda= 0.183854 statistics sampled from 42773 (42778) to 42773 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.87), E-opt: 0.2 (0.502), width: 16 Scan time: 2.590 The best scores are: opt bits E(85289) NP_004065 (OMIM: 123870) cytochrome c oxidase subu ( 69) 457 127.4 1.8e-30 NP_892016 (OMIM: 616855) cytochrome c oxidase subu ( 72) 137 42.5 6.8e-05 >>NP_004065 (OMIM: 123870) cytochrome c oxidase subunit (69 aa) initn: 457 init1: 457 opt: 457 Z-score: 667.9 bits: 127.4 E(85289): 1.8e-30 Smith-Waterman score: 457; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69) 10 20 30 40 50 60 pF1KE6 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS 10 20 30 40 50 60 pF1KE6 HLETYRRPE ::::::::: NP_004 HLETYRRPE >>NP_892016 (OMIM: 616855) cytochrome c oxidase subunit (72 aa) initn: 141 init1: 125 opt: 137 Z-score: 208.8 bits: 42.5 E(85289): 6.8e-05 Smith-Waterman score: 137; 46.9% identity (75.5% similar) in 49 aa overlap (20-67:24-71) 10 20 30 40 50 pF1KE6 MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGK-LGIMELAVGLTSCFVTFLLPA :.:: :: ::. . :. :.::::. :.::: :: NP_892 MPLLRGRCPARRHYRRLALLGLQPAPRFA-HSGPPRQRPLSAAEMAVGLVVFFTTFLTPA 10 20 30 40 50 60 pF1KE6 GWILSHLETYRRPE ...:..:. .:: NP_892 AYVLGNLKQFRRN 60 70 69 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:14:34 2016 done: Tue Nov 8 10:14:34 2016 Total Scan time: 2.590 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]