FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1663, 183 aa 1>>>pF1KE1663 183 - 183 aa - 183 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1635+/-0.000299; mu= 14.5235+/- 0.019 mean_var=75.4929+/-14.697, 0's: 0 Z-trim(118.6): 100 B-trim: 58 in 1/53 Lambda= 0.147612 statistics sampled from 31628 (31750) to 31628 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.747), E-opt: 0.2 (0.372), width: 16 Scan time: 5.140 The best scores are: opt bits E(85289) NP_003335 (OMIM: 601082) ubiquitin-conjugating enz ( 183) 1228 270.0 1.5e-72 NP_001189427 (OMIM: 601082) ubiquitin-conjugating ( 113) 746 167.2 8.4e-42 NP_874356 (OMIM: 601082) ubiquitin-conjugating enz ( 152) 546 124.7 7e-29 NP_003328 (OMIM: 179095) ubiquitin-conjugating enz ( 152) 348 82.5 3.4e-16 NP_003327 (OMIM: 300860,312180) ubiquitin-conjugat ( 152) 346 82.1 4.6e-16 NP_001269090 (OMIM: 300860,312180) ubiquitin-conju ( 119) 330 78.6 4.1e-15 XP_016872098 (OMIM: 602961) PREDICTED: ubiquitin-c ( 110) 314 75.2 4.1e-14 NP_003329 (OMIM: 602961) ubiquitin-conjugating enz ( 147) 314 75.3 5.1e-14 NP_005330 (OMIM: 602846) ubiquitin-conjugating enz ( 200) 315 75.6 5.5e-14 NP_862821 (OMIM: 602962) ubiquitin-conjugating enz ( 118) 309 74.1 9e-14 NP_003330 (OMIM: 602962) ubiquitin-conjugating enz ( 147) 309 74.2 1.1e-13 XP_016865309 (OMIM: 602962) PREDICTED: ubiquitin-c ( 173) 309 74.3 1.2e-13 XP_016864073 (OMIM: 602963) PREDICTED: ubiquitin-c ( 118) 303 72.8 2.2e-13 NP_001287724 (OMIM: 602963) ubiquitin-conjugating ( 118) 303 72.8 2.2e-13 NP_871615 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871616 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_003331 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871619 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871620 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871617 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871618 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 303 72.9 2.6e-13 NP_871622 (OMIM: 602963) ubiquitin-conjugating enz ( 149) 303 72.9 2.6e-13 NP_871621 (OMIM: 602963) ubiquitin-conjugating enz ( 148) 300 72.3 4e-13 NP_001191809 (OMIM: 602961) ubiquitin-conjugating ( 109) 298 71.8 4.3e-13 NP_003339 (OMIM: 603679) ubiquitin-conjugating enz ( 152) 295 71.2 8.6e-13 NP_001297255 (OMIM: 610538,616435) ubiquitin-conju ( 167) 292 70.6 1.4e-12 NP_054895 (OMIM: 610538,616435) ubiquitin-conjugat ( 197) 292 70.7 1.6e-12 NP_008950 (OMIM: 605574) ubiquitin-conjugating enz ( 179) 286 69.4 3.7e-12 NP_861517 (OMIM: 605574) ubiquitin-conjugating enz ( 140) 282 68.4 5.5e-12 NP_001189405 (OMIM: 602916) ubiquitin-conjugating ( 160) 279 67.8 9.5e-12 NP_001104582 (OMIM: 602846) ubiquitin-conjugating ( 157) 270 65.9 3.5e-11 NP_872607 (OMIM: 602916) ubiquitin-conjugating enz ( 176) 270 66.0 3.8e-11 NP_003332 (OMIM: 602916) ubiquitin-conjugating enz ( 193) 270 66.0 4.1e-11 XP_005246301 (OMIM: 604151) PREDICTED: ubiquitin-c ( 207) 270 66.0 4.3e-11 NP_001265484 (OMIM: 604151) ubiquitin-conjugating ( 207) 270 66.0 4.3e-11 NP_001265483 (OMIM: 604151) ubiquitin-conjugating ( 207) 270 66.0 4.3e-11 NP_872619 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 270 66.0 4.3e-11 NP_006348 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 270 66.0 4.3e-11 NP_689866 (OMIM: 602163) ubiquitin-conjugating enz ( 201) 268 65.6 5.7e-11 XP_005265489 (OMIM: 602163) PREDICTED: ubiquitin-c ( 201) 268 65.6 5.7e-11 NP_055316 (OMIM: 610309) ubiquitin-conjugating enz ( 222) 266 65.2 8.3e-11 NP_003338 (OMIM: 603721) ubiquitin-conjugating enz ( 154) 264 64.6 8.4e-11 NP_001243284 (OMIM: 603721) ubiquitin-conjugating ( 212) 264 64.7 1.1e-10 NP_861516 (OMIM: 605574) ubiquitin-conjugating enz ( 150) 261 64.0 1.3e-10 NP_001243285 (OMIM: 603721) ubiquitin-conjugating ( 122) 255 62.6 2.7e-10 NP_004214 (OMIM: 603890) ubiquitin/ISG15-conjugati ( 153) 250 61.6 6.6e-10 NP_919237 (OMIM: 601661) SUMO-conjugating enzyme U ( 158) 247 61.0 1.1e-09 NP_919235 (OMIM: 601661) SUMO-conjugating enzyme U ( 158) 247 61.0 1.1e-09 NP_919236 (OMIM: 601661) SUMO-conjugating enzyme U ( 158) 247 61.0 1.1e-09 NP_003336 (OMIM: 601661) SUMO-conjugating enzyme U ( 158) 247 61.0 1.1e-09 >>NP_003335 (OMIM: 601082) ubiquitin-conjugating enzyme (183 aa) initn: 1228 init1: 1228 opt: 1228 Z-score: 1423.4 bits: 270.0 E(85289): 1.5e-72 Smith-Waterman score: 1228; 100.0% identity (100.0% similar) in 183 aa overlap (1-183:1-183) 10 20 30 40 50 60 pF1KE1 MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 YPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPID :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 YPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPID 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE1 PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD 130 140 150 160 170 180 pF1KE1 MEL ::: NP_003 MEL >>NP_001189427 (OMIM: 601082) ubiquitin-conjugating enzy (113 aa) initn: 746 init1: 746 opt: 746 Z-score: 871.5 bits: 167.2 E(85289): 8.4e-42 Smith-Waterman score: 746; 100.0% identity (100.0% similar) in 113 aa overlap (71-183:1-113) 50 60 70 80 90 100 pF1KE1 PQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYD :::::::::::::::::::::::::::::: NP_001 MNKIFHPNIDEASGTVCLDVINQTWTALYD 10 20 30 110 120 130 140 150 160 pF1KE1 LTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 LTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEG 40 50 60 70 80 90 170 180 pF1KE1 TGDSSSESSMSDFSEDEAQDMEL ::::::::::::::::::::::: NP_001 TGDSSSESSMSDFSEDEAQDMEL 100 110 >>NP_874356 (OMIM: 601082) ubiquitin-conjugating enzyme (152 aa) initn: 546 init1: 546 opt: 546 Z-score: 639.5 bits: 124.7 E(85289): 7e-29 Smith-Waterman score: 940; 83.1% identity (83.1% similar) in 183 aa overlap (1-183:1-152) 10 20 30 40 50 60 pF1KE1 MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_874 MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 YPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPID :::::::: ::::::::::::::::::::: NP_874 YPFKSPSI-------------------------------DLTNIFESFLPQLLAYPNPID 70 80 130 140 150 160 170 180 pF1KE1 PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_874 PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD 90 100 110 120 130 140 pF1KE1 MEL ::: NP_874 MEL 150 >>NP_003328 (OMIM: 179095) ubiquitin-conjugating enzyme (152 aa) initn: 308 init1: 169 opt: 348 Z-score: 411.7 bits: 82.5 E(85289): 3.4e-16 Smith-Waterman score: 348; 33.1% identity (70.9% similar) in 148 aa overlap (5-147:3-147) 10 20 30 40 50 pF1KE1 MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVK-----FYGPQGTPYEGGVWKVRV .:..::. : .: :. : . :. .: . ..::.:::.: :..:. . NP_003 MSTPARRRLMRDFKRLQEDP-PVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVI 10 20 30 40 50 60 70 80 90 100 110 pF1KE1 DLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAY .. ..:: : :.. :..:.::::. :.:..:::.... :. ::...:. : . .:: NP_003 EFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDE 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE1 PNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSE ::: .: :..:: .: . .::..... ... NP_003 PNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS 120 130 140 150 180 pF1KE1 DEAQDMEL >>NP_003327 (OMIM: 300860,312180) ubiquitin-conjugating (152 aa) initn: 308 init1: 169 opt: 346 Z-score: 409.4 bits: 82.1 E(85289): 4.6e-16 Smith-Waterman score: 346; 33.3% identity (72.1% similar) in 147 aa overlap (5-147:3-147) 10 20 30 40 50 pF1KE1 MSSPSPGKRRMDTDVVKLIESKHE-VTILGGLNEFVVK---FYGPQGTPYEGGVWKVRVD .:..::. : .: :. :. . :...: ..::.:::.: :..:. .. NP_003 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIE 10 20 30 40 50 60 70 80 90 100 110 pF1KE1 LPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYP . ..:: : :.. :..:.::::. :.:..:::.... :. ::...:. : . .:: : NP_003 FTEEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDEP 60 70 80 90 100 110 120 130 140 150 160 170 pF1KE1 NPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSED :: .: :..:: .: . .::..... ... NP_003 NPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC 120 130 140 150 180 pF1KE1 EAQDMEL >>NP_001269090 (OMIM: 300860,312180) ubiquitin-conjugati (119 aa) initn: 308 init1: 169 opt: 330 Z-score: 392.4 bits: 78.6 E(85289): 4.1e-15 Smith-Waterman score: 330; 36.7% identity (78.0% similar) in 109 aa overlap (39-147:8-114) 10 20 30 40 50 60 pF1KE1 RRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSI .::.:::.: :..:. ... ..:: : :.. NP_001 MVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV 10 20 30 70 80 90 100 110 120 pF1KE1 GFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAA :..:.::::. :.:..:::.... :. ::...:. : . .:: ::: .: :..:: NP_001 RFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDEPNPNSPANSQAAQ 40 50 60 70 80 90 130 140 150 160 170 180 pF1KE1 MYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL .: . .::..... ... NP_001 LYQENKREYEKRVSAIVEQSWRDC 100 110 >>XP_016872098 (OMIM: 602961) PREDICTED: ubiquitin-conju (110 aa) initn: 291 init1: 160 opt: 314 Z-score: 374.4 bits: 75.2 E(85289): 4.1e-14 Smith-Waterman score: 314; 40.9% identity (70.0% similar) in 110 aa overlap (40-149:2-109) 10 20 30 40 50 60 pF1KE1 RMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIG :: . :.:::. . : .: :::: :.:. XP_016 MGPPDSAYQGGVFFLTVHFPTDYPFKPPKIA 10 20 30 70 80 90 100 110 120 pF1KE1 FMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAM : .::.::::. ..:..:::.. . :. ..... : . .:: ::: ::: : : . XP_016 FTTKIYHPNIN-SNGSICLDILRSQWSPALTVSKVLLS-ICSLLCDPNPDDPLVPDIAQI 40 50 60 70 80 130 140 150 160 170 180 pF1KE1 YLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL : :.:... .:. :::: XP_016 YKSDKEKYNRHAREWTQKYAM 90 100 110 >>NP_003329 (OMIM: 602961) ubiquitin-conjugating enzyme (147 aa) initn: 291 init1: 160 opt: 314 Z-score: 372.7 bits: 75.3 E(85289): 5.1e-14 Smith-Waterman score: 314; 40.9% identity (70.0% similar) in 110 aa overlap (40-149:39-146) 10 20 30 40 50 60 pF1KE1 RMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIG :: . :.:::. . : .: :::: :.:. NP_003 ELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 FMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAM : .::.::::. ..:..:::.. . :. ..... : . .:: ::: ::: : : . NP_003 FTTKIYHPNIN-SNGSICLDILRSQWSPALTVSKVLLS-ICSLLCDPNPDDPLVPDIAQI 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE1 YLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL : :.:... .:. :::: NP_003 YKSDKEKYNRHAREWTQKYAM 130 140 >>NP_005330 (OMIM: 602846) ubiquitin-conjugating enzyme (200 aa) initn: 313 init1: 242 opt: 315 Z-score: 372.0 bits: 75.6 E(85289): 5.5e-14 Smith-Waterman score: 315; 35.9% identity (68.3% similar) in 145 aa overlap (9-149:10-153) 10 20 30 40 50 pF1KE1 MSSPSPGKRRMDTDVVKLIE-SKHEVTI-LGGLN--EFVVKFYGPQGTPYEGGVWKVRV .: .:.: : ::... . : : :. .. :: :::::: ..... NP_005 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI 10 20 30 40 50 60 60 70 80 90 100 110 pF1KE1 DLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAY .:. :::. :.. :..::.::::. ..:..:::.... :.: . : ... : : ::: NP_005 KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLS-LQALLAA 70 80 90 100 110 120 130 140 150 160 170 pF1KE1 PNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSE .: :: .. .: .: . :: .:: . . . :: NP_005 AEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAV 120 130 140 150 160 170 180 pF1KE1 DEAQDMEL NP_005 IVALSSKSWDVETATELLLSN 180 190 200 >>NP_862821 (OMIM: 602962) ubiquitin-conjugating enzyme (118 aa) initn: 285 init1: 167 opt: 309 Z-score: 368.3 bits: 74.1 E(85289): 9e-14 Smith-Waterman score: 309; 38.2% identity (70.9% similar) in 110 aa overlap (40-149:10-117) 10 20 30 40 50 60 pF1KE1 RMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIG ::. .::.:::. . . .: :::: :... NP_862 MFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVA 10 20 30 70 80 90 100 110 120 pF1KE1 FMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAM : ..:.::::. ..:..:::.. . :. ..... : . .:: ::: ::: . : . NP_862 FTTRIYHPNIN-SNGSICLDILRSQWSPALTISKVLLS-ICSLLCDPNPDDPLVPEIARI 40 50 60 70 80 90 130 140 150 160 170 180 pF1KE1 YLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL : :.:.. .:. :::: NP_862 YKTDREKYNRIAREWTQKYAM 100 110 183 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 16:16:20 2016 done: Sun Nov 6 16:16:21 2016 Total Scan time: 5.140 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]