FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5165, 140 aa 1>>>pF1KE5165 140 - 140 aa - 140 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2413+/-0.000682; mu= 11.1564+/- 0.041 mean_var=53.0351+/-10.655, 0's: 0 Z-trim(108.7): 6 B-trim: 541 in 1/48 Lambda= 0.176113 statistics sampled from 10369 (10372) to 10369 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.715), E-opt: 0.2 (0.319), width: 16 Scan time: 1.750 The best scores are: opt bits E(32554) CCDS5704.1 POP7 gene_id:10248|Hs108|chr7 ( 140) 906 237.5 2e-63 >>CCDS5704.1 POP7 gene_id:10248|Hs108|chr7 (140 aa) initn: 906 init1: 906 opt: 906 Z-score: 1252.1 bits: 237.5 E(32554): 2e-63 Smith-Waterman score: 906; 100.0% identity (100.0% similar) in 140 aa overlap (1-140:1-140) 10 20 30 40 50 60 pF1KE5 MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS57 MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS57 RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP 70 80 90 100 110 120 130 140 pF1KE5 LTRIRNNSAIHIRVFRVTPK :::::::::::::::::::: CCDS57 LTRIRNNSAIHIRVFRVTPK 130 140 140 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:12:42 2016 done: Mon Nov 7 22:12:43 2016 Total Scan time: 1.750 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]