FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6166, 80 aa 1>>>pF1KE6166 80 - 80 aa - 80 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7728+/-0.000296; mu= 9.6328+/- 0.018 mean_var=42.8962+/- 8.646, 0's: 0 Z-trim(115.8): 12 B-trim: 0 in 0/50 Lambda= 0.195824 statistics sampled from 26452 (26464) to 26452 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.722), E-opt: 0.2 (0.31), width: 16 Scan time: 3.790 The best scores are: opt bits E(85289) XP_011511934 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511935 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511936 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511937 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511939 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511932 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511933 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_005248113 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 NP_570972 (OMIM: 609811) cytochrome c oxidase subu ( 81) 547 161.1 1.8e-40 XP_011511940 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 XP_011511938 (OMIM: 609811) PREDICTED: cytochrome ( 81) 547 161.1 1.8e-40 NP_001857 (OMIM: 300885,300887) cytochrome c oxida ( 80) 428 127.5 2.3e-30 >>XP_011511934 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511935 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511936 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511937 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511939 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511932 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511933 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_005248113 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_005 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_005 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>NP_570972 (OMIM: 609811) cytochrome c oxidase subunit (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_570 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: NP_570 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511940 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 547 init1: 547 opt: 547 Z-score: 847.6 bits: 161.1 E(85289): 1.8e-40 Smith-Waterman score: 547; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 IGIEWNLSPVGRVTPKEWKHQ ::::::::::::::::::::: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 80 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:00:41 2016 done: Tue Nov 8 10:00:42 2016 Total Scan time: 3.790 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]