FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3802, 74 aa 1>>>pF1KE3802 74 - 74 aa - 74 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9373+/-0.00046; mu= 9.2351+/- 0.028 mean_var=53.9328+/-10.475, 0's: 0 Z-trim(114.8): 4 B-trim: 2 in 1/53 Lambda= 0.174642 statistics sampled from 15403 (15404) to 15403 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.849), E-opt: 0.2 (0.473), width: 16 Scan time: 1.240 The best scores are: opt bits E(32554) CCDS3085.1 ANAPC13 gene_id:25847|Hs108|chr3 ( 74) 509 134.9 4.4e-33 >>CCDS3085.1 ANAPC13 gene_id:25847|Hs108|chr3 (74 aa) initn: 509 init1: 509 opt: 509 Z-score: 707.4 bits: 134.9 E(32554): 4.4e-33 Smith-Waterman score: 509; 100.0% identity (100.0% similar) in 74 aa overlap (1-74:1-74) 10 20 30 40 50 60 pF1KE3 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS30 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL 10 20 30 40 50 60 70 pF1KE3 ALQYLHENVPPIGN :::::::::::::: CCDS30 ALQYLHENVPPIGN 70 74 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 06:40:58 2016 done: Sun Nov 6 06:40:58 2016 Total Scan time: 1.240 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]