FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5190, 132 aa 1>>>pF1KE5190 132 - 132 aa - 132 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1539+/-0.000284; mu= 11.4695+/- 0.018 mean_var=59.2130+/-11.357, 0's: 0 Z-trim(117.9): 13 B-trim: 18 in 1/55 Lambda= 0.166673 statistics sampled from 30399 (30409) to 30399 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.749), E-opt: 0.2 (0.357), width: 16 Scan time: 3.950 The best scores are: opt bits E(85289) NP_000967 (OMIM: 180475) 60S ribosomal protein L12 ( 165) 620 156.7 1.2e-38 >>NP_000967 (OMIM: 180475) 60S ribosomal protein L12 [Ho (165 aa) initn: 859 init1: 620 opt: 620 Z-score: 814.7 bits: 156.7 E(85289): 1.2e-38 Smith-Waterman score: 790; 79.9% identity (79.9% similar) in 164 aa overlap (2-132:2-165) 10 20 30 pF1KE5 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGL----------------------- :::::::::::::::::::::::::::::::::::: NP_000 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV 10 20 30 40 50 60 40 50 60 70 80 pF1KE5 ----------IEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS :::::::::::::::::::::::::::::::::::::::::::::::::: NP_000 KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS 70 80 90 100 110 120 90 100 110 120 130 pF1KE5 LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS ::::::::::::::::::::::::::::::::::::::::::::: NP_000 LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS 130 140 150 160 132 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:26:05 2016 done: Mon Nov 7 22:26:06 2016 Total Scan time: 3.950 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]