FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5190, 132 aa 1>>>pF1KE5190 132 - 132 aa - 132 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0045+/-0.00059; mu= 12.4298+/- 0.036 mean_var=57.9854+/-11.146, 0's: 0 Z-trim(111.0): 7 B-trim: 2 in 1/50 Lambda= 0.168428 statistics sampled from 12052 (12055) to 12052 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.761), E-opt: 0.2 (0.37), width: 16 Scan time: 1.530 The best scores are: opt bits E(32554) CCDS6872.1 RPL12 gene_id:6136|Hs108|chr9 ( 165) 620 158.1 1.8e-39 >>CCDS6872.1 RPL12 gene_id:6136|Hs108|chr9 (165 aa) initn: 859 init1: 620 opt: 620 Z-score: 822.1 bits: 158.1 E(32554): 1.8e-39 Smith-Waterman score: 790; 79.9% identity (79.9% similar) in 164 aa overlap (2-132:2-165) 10 20 30 pF1KE5 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGL----------------------- :::::::::::::::::::::::::::::::::::: CCDS68 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV 10 20 30 40 50 60 40 50 60 70 80 pF1KE5 ----------IEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS :::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS 70 80 90 100 110 120 90 100 110 120 130 pF1KE5 LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS ::::::::::::::::::::::::::::::::::::::::::::: CCDS68 LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS 130 140 150 160 132 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:26:05 2016 done: Mon Nov 7 22:26:05 2016 Total Scan time: 1.530 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]