FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6133, 51 aa 1>>>pF1KE6133 51 - 51 aa - 51 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7449+/-0.000227; mu= 9.5484+/- 0.014 mean_var=85.0197+/-16.283, 0's: 0 Z-trim(125.3): 58 B-trim: 0 in 0/55 Lambda= 0.139096 statistics sampled from 48612 (48688) to 48612 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.864), E-opt: 0.2 (0.571), width: 16 Scan time: 3.070 The best scores are: opt bits E(85289) NP_002752 (OMIM: 182880) sperm protamine P1 [Homo ( 51) 390 85.6 3.8e-18 NP_002753 (OMIM: 182890) protamine-2 isoform 1 [Ho ( 102) 166 41.0 0.0002 >>NP_002752 (OMIM: 182880) sperm protamine P1 [Homo sapi (51 aa) initn: 390 init1: 390 opt: 390 Z-score: 446.7 bits: 85.6 E(85289): 3.8e-18 Smith-Waterman score: 390; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51) 10 20 30 40 50 pF1KE6 MARYRCCRSQSRSRYYRQRQRSRRRRRRSCQTRRRAMRCCRPRYRPRCRRH ::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 MARYRCCRSQSRSRYYRQRQRSRRRRRRSCQTRRRAMRCCRPRYRPRCRRH 10 20 30 40 50 >>NP_002753 (OMIM: 182890) protamine-2 isoform 1 [Homo s (102 aa) initn: 175 init1: 120 opt: 166 Z-score: 200.2 bits: 41.0 E(85289): 0.0002 Smith-Waterman score: 166; 52.0% identity (66.0% similar) in 50 aa overlap (3-51:54-102) 10 20 30 pF1KE6 MARYRCCRSQSRSRYYRQRQRS-RRRRRRSCQ : : : . : .:...:: :::.::::. NP_002 QEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCR 30 40 50 60 70 80 40 50 pF1KE6 TRRRAMRCCRPRYRPRCRRH ::: : :: : : :::: NP_002 HRRRHRRGCRTRKRT-CRRH 90 100 51 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:45:02 2016 done: Tue Nov 8 09:45:02 2016 Total Scan time: 3.070 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]