FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6131, 63 aa 1>>>pF1KE6131 63 - 63 aa - 63 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3861+/-0.000251; mu= 10.2819+/- 0.016 mean_var=40.7168+/- 8.686, 0's: 0 Z-trim(120.1): 3 B-trim: 1268 in 1/52 Lambda= 0.200996 statistics sampled from 34983 (34986) to 34983 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.813), E-opt: 0.2 (0.41), width: 16 Scan time: 3.450 The best scores are: opt bits E(85289) NP_001858 (OMIM: 603774) cytochrome c oxidase subu ( 63) 420 127.6 1.3e-30 >>NP_001858 (OMIM: 603774) cytochrome c oxidase subunit (63 aa) initn: 420 init1: 420 opt: 420 Z-score: 670.6 bits: 127.6 E(85289): 1.3e-30 Smith-Waterman score: 420; 100.0% identity (100.0% similar) in 63 aa overlap (1-63:1-63) 10 20 30 40 50 60 pF1KE6 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL 10 20 30 40 50 60 pF1KE6 LKT ::: NP_001 LKT 63 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:43:42 2016 done: Tue Nov 8 09:43:43 2016 Total Scan time: 3.450 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]