FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6711, 79 aa 1>>>pF1KB6711 79 - 79 aa - 79 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.0137+/-0.000247; mu= 14.6009+/- 0.015 mean_var=47.4111+/- 9.451, 0's: 0 Z-trim(120.7): 9 B-trim: 87 in 1/55 Lambda= 0.186266 statistics sampled from 36234 (36243) to 36234 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.814), E-opt: 0.2 (0.425), width: 16 Scan time: 3.680 The best scores are: opt bits E(85289) NP_001817 (OMIM: 116900) cyclin-dependent kinases ( 79) 561 156.8 3.4e-39 NP_001818 (OMIM: 116901) cyclin-dependent kinases ( 79) 466 131.3 1.6e-31 >>NP_001817 (OMIM: 116900) cyclin-dependent kinases regu (79 aa) initn: 561 init1: 561 opt: 561 Z-score: 824.7 bits: 156.8 E(85289): 3.4e-39 Smith-Waterman score: 561; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKKPKK ::::::::::::::::::: NP_001 EPEPHILLFRRPLPKKPKK 70 >>NP_001818 (OMIM: 116901) cyclin-dependent kinases regu (79 aa) initn: 469 init1: 458 opt: 466 Z-score: 686.8 bits: 131.3 E(85289): 1.6e-31 Smith-Waterman score: 466; 81.0% identity (91.1% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH :.:::::::::: ::..::::::::....: ::::::::: ::: :::::: :::::::: NP_001 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKKPKK ::::::::::::::: .: NP_001 EPEPHILLFRRPLPKDQQK 70 79 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 01:19:32 2016 done: Mon Nov 7 01:19:33 2016 Total Scan time: 3.680 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]