FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6141, 101 aa 1>>>pF1KE6141 101 - 101 aa - 101 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4279+/-0.000326; mu= 13.1298+/- 0.020 mean_var=50.8426+/-10.735, 0's: 0 Z-trim(114.7): 20 B-trim: 35 in 1/50 Lambda= 0.179871 statistics sampled from 24669 (24688) to 24669 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.678), E-opt: 0.2 (0.289), width: 16 Scan time: 3.700 The best scores are: opt bits E(85289) NP_001268461 (OMIM: 607632,613736) gamma-secretase ( 101) 709 191.2 2.4e-49 NP_758844 (OMIM: 607632,613736) gamma-secretase su ( 101) 709 191.2 2.4e-49 >>NP_001268461 (OMIM: 607632,613736) gamma-secretase sub (101 aa) initn: 709 init1: 709 opt: 709 Z-score: 1006.9 bits: 191.2 E(85289): 2.4e-49 Smith-Waterman score: 709; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101) 10 20 30 40 50 60 pF1KE6 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS 10 20 30 40 50 60 70 80 90 100 pF1KE6 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP ::::::::::::::::::::::::::::::::::::::::: NP_001 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP 70 80 90 100 >>NP_758844 (OMIM: 607632,613736) gamma-secretase subuni (101 aa) initn: 709 init1: 709 opt: 709 Z-score: 1006.9 bits: 191.2 E(85289): 2.4e-49 Smith-Waterman score: 709; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101) 10 20 30 40 50 60 pF1KE6 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_758 MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS 10 20 30 40 50 60 70 80 90 100 pF1KE6 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP ::::::::::::::::::::::::::::::::::::::::: NP_758 AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP 70 80 90 100 101 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:49:13 2016 done: Tue Nov 8 09:49:14 2016 Total Scan time: 3.700 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]