FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5113, 158 aa 1>>>pF1KE5113 158 - 158 aa - 158 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9425+/-0.000381; mu= 13.5426+/- 0.024 mean_var=55.6084+/-11.526, 0's: 0 Z-trim(110.8): 19 B-trim: 0 in 0/50 Lambda= 0.171990 statistics sampled from 19275 (19277) to 19275 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.618), E-opt: 0.2 (0.226), width: 16 Scan time: 4.670 The best scores are: opt bits E(85289) NP_001006 (OMIM: 180471) 40S ribosomal protein S11 ( 158) 1044 267.1 8.6e-72 >>NP_001006 (OMIM: 180471) 40S ribosomal protein S11 [Ho (158 aa) initn: 1044 init1: 1044 opt: 1044 Z-score: 1409.9 bits: 267.1 E(85289): 8.6e-72 Smith-Waterman score: 1044; 100.0% identity (100.0% similar) in 158 aa overlap (1-158:1-158) 10 20 30 40 50 60 pF1KE5 MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKC 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 PFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 PFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDV 70 80 90 100 110 120 130 140 150 pF1KE5 QIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF :::::::::::::::::::::::::::::::::::::: NP_001 QIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF 130 140 150 158 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:27:53 2016 done: Mon Nov 7 21:27:54 2016 Total Scan time: 4.670 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]