FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1439, 129 aa 1>>>pF1KE1439 129 - 129 aa - 129 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9372+/-0.000529; mu= 14.0929+/- 0.032 mean_var=75.7846+/-14.811, 0's: 0 Z-trim(115.7): 6 B-trim: 55 in 2/49 Lambda= 0.147327 statistics sampled from 16245 (16250) to 16245 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.834), E-opt: 0.2 (0.499), width: 16 Scan time: 1.780 The best scores are: opt bits E(32554) CCDS10489.1 TNFRSF12A gene_id:51330|Hs108|chr16 ( 129) 908 200.8 2e-52 >>CCDS10489.1 TNFRSF12A gene_id:51330|Hs108|chr16 (129 aa) initn: 908 init1: 908 opt: 908 Z-score: 1054.7 bits: 200.8 E(32554): 2e-52 Smith-Waterman score: 908; 100.0% identity (100.0% similar) in 129 aa overlap (1-129:1-129) 10 20 30 40 50 60 pF1KE1 MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE 70 80 90 100 110 120 pF1KE1 GCPAVALIQ ::::::::: CCDS10 GCPAVALIQ 129 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 02:35:49 2016 done: Mon Nov 7 02:35:50 2016 Total Scan time: 1.780 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]