Result of FASTA (ccds) for pFN21AE5104
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5104, 117 aa
  1>>>pF1KE5104 117 - 117 aa - 117 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9202+/-0.00066; mu= 12.4462+/- 0.039
 mean_var=54.9393+/-11.153, 0's: 0 Z-trim(109.2): 8  B-trim: 304 in 1/48
 Lambda= 0.173034
 statistics sampled from 10737 (10739) to 10737 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.718), E-opt: 0.2 (0.33), width:  16
 Scan time:  1.060

The best scores are:                                      opt bits E(32554)
CCDS3680.1 RPL34 gene_id:6164|Hs108|chr4           ( 117)  756 195.9 4.6e-51


>>CCDS3680.1 RPL34 gene_id:6164|Hs108|chr4                (117 aa)
 initn: 756 init1: 756 opt: 756  Z-score: 1030.2  bits: 195.9 E(32554): 4.6e-51
Smith-Waterman score: 756; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117)

               10        20        30        40        50        60
pF1KE5 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS36 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR
               10        20        30        40        50        60

               70        80        90       100       110       
pF1KE5 PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS36 PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK
               70        80        90       100       110       




117 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:06:53 2016 done: Mon Nov  7 21:06:53 2016
 Total Scan time:  1.060 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com