FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5104, 117 aa 1>>>pF1KE5104 117 - 117 aa - 117 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9202+/-0.00066; mu= 12.4462+/- 0.039 mean_var=54.9393+/-11.153, 0's: 0 Z-trim(109.2): 8 B-trim: 304 in 1/48 Lambda= 0.173034 statistics sampled from 10737 (10739) to 10737 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.718), E-opt: 0.2 (0.33), width: 16 Scan time: 1.060 The best scores are: opt bits E(32554) CCDS3680.1 RPL34 gene_id:6164|Hs108|chr4 ( 117) 756 195.9 4.6e-51 >>CCDS3680.1 RPL34 gene_id:6164|Hs108|chr4 (117 aa) initn: 756 init1: 756 opt: 756 Z-score: 1030.2 bits: 195.9 E(32554): 4.6e-51 Smith-Waterman score: 756; 100.0% identity (100.0% similar) in 117 aa overlap (1-117:1-117) 10 20 30 40 50 60 pF1KE5 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS36 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 10 20 30 40 50 60 70 80 90 100 110 pF1KE5 PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK ::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS36 PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK 70 80 90 100 110 117 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:06:53 2016 done: Mon Nov 7 21:06:53 2016 Total Scan time: 1.060 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]