FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6119, 75 aa 1>>>pF1KE6119 75 - 75 aa - 75 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.1981+/-0.000276; mu= 12.5952+/- 0.017 mean_var=42.0498+/- 8.231, 0's: 0 Z-trim(117.2): 2 B-trim: 22 in 1/50 Lambda= 0.197785 statistics sampled from 28964 (28966) to 28964 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.75), E-opt: 0.2 (0.34), width: 16 Scan time: 2.790 The best scores are: opt bits E(85289) NP_004365 (OMIM: 124090) cytochrome c oxidase subu ( 75) 489 145.6 7e-36 XP_016868509 (OMIM: 124090) PREDICTED: cytochrome ( 75) 489 145.6 7e-36 >>NP_004365 (OMIM: 124090) cytochrome c oxidase subunit (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 765.1 bits: 145.6 E(85289): 7e-36 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KE6 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK 10 20 30 40 50 60 70 pF1KE6 DFEEMRKAGIFQSVK ::::::::::::::: NP_004 DFEEMRKAGIFQSVK 70 >>XP_016868509 (OMIM: 124090) PREDICTED: cytochrome c ox (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 765.1 bits: 145.6 E(85289): 7e-36 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KE6 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK 10 20 30 40 50 60 70 pF1KE6 DFEEMRKAGIFQSVK ::::::::::::::: XP_016 DFEEMRKAGIFQSVK 70 75 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:37:04 2016 done: Tue Nov 8 09:37:04 2016 Total Scan time: 2.790 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]