FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6119, 75 aa 1>>>pF1KE6119 75 - 75 aa - 75 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3778+/-0.000532; mu= 11.7223+/- 0.032 mean_var=42.5700+/- 8.362, 0's: 0 Z-trim(110.6): 3 B-trim: 0 in 0/49 Lambda= 0.196572 statistics sampled from 11723 (11724) to 11723 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.77), E-opt: 0.2 (0.36), width: 16 Scan time: 0.870 The best scores are: opt bits E(32554) CCDS6284.1 COX6C gene_id:1345|Hs108|chr8 ( 75) 489 144.8 4.9e-36 >>CCDS6284.1 COX6C gene_id:1345|Hs108|chr8 (75 aa) initn: 489 init1: 489 opt: 489 Z-score: 760.5 bits: 144.8 E(32554): 4.9e-36 Smith-Waterman score: 489; 100.0% identity (100.0% similar) in 75 aa overlap (1-75:1-75) 10 20 30 40 50 60 pF1KE6 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS62 MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK 10 20 30 40 50 60 70 pF1KE6 DFEEMRKAGIFQSVK ::::::::::::::: CCDS62 DFEEMRKAGIFQSVK 70 75 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:37:03 2016 done: Tue Nov 8 09:37:03 2016 Total Scan time: 0.870 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]