Result of FASTA (ccds) for pFN21AE0211
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0211, 86 aa
  1>>>pF1KE0211 86 - 86 aa - 86 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5952+/-0.000476; mu= 11.2549+/- 0.029
 mean_var=42.9555+/- 8.486, 0's: 0 Z-trim(113.2): 6  B-trim: 0 in 0/50
 Lambda= 0.195688
 statistics sampled from 13863 (13865) to 13863 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.818), E-opt: 0.2 (0.426), width:  16
 Scan time:  1.130

The best scores are:                                      opt bits E(32554)
CCDS5204.1 SF3B5 gene_id:83443|Hs108|chr6          (  86)  608 177.6 8.2e-46


>>CCDS5204.1 SF3B5 gene_id:83443|Hs108|chr6               (86 aa)
 initn: 608 init1: 608 opt: 608  Z-score: 935.9  bits: 177.6 E(32554): 8.2e-46
Smith-Waterman score: 608; 100.0% identity (100.0% similar) in 86 aa overlap (1-86:1-86)

               10        20        30        40        50        60
pF1KE0 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENES
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS52 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENES
               10        20        30        40        50        60

               70        80      
pF1KE0 KARVRFNLMEKMLQPCGPPADKPEEN
       ::::::::::::::::::::::::::
CCDS52 KARVRFNLMEKMLQPCGPPADKPEEN
               70        80      




86 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 21:08:15 2016 done: Thu Nov  3 21:08:15 2016
 Total Scan time:  1.130 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com