SSEARCH searches a sequence database using the Smith-Waterman algorithm version 2.0u54, July. 1996 Please cite: T. F. Smith and M. S. Waterman, (1981) J. Mol. Biol. 147:195-197; W.R. Pearson (1991) Genomics 11:635-650 >MRG7.P1 (Universal genetic code) : 40 aa vs library searching s520101 library 115 residues in 1 sequences The best scores are: s-w S520101, 115 bases, 1888 checksum. (115) 155 >>S520101, 115 bases, 1888 checksum. (115 aa) Smith-Waterman score: 155; 39.535% identity in 43 aa overlap 10 20 30 40 MRG7.P HPCMCS-MYV--CNLSCLFMQHNMSSVHICMYCLCVYVCIHVH : :.: .:. : ::.... .. ...::: ::.:::: .: S52010 ISIHTCICVYVYIHICVCSCMYVSMHLP-MYVCMYVLCTYVCICMHPPISVFGGSGDKPR 10 20 30 40 50 S52010 VFHLLGKCCTTTRHSTLFFLFLSIESTGLGLVRWLRGKSTRLLFQRSEVQIPATTW 60 70 80 90 100 110 Library scan: 0:00:00 total CPU time: 0:00:00